Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate WP_061535235.1 CAter10_RS08205 aldehyde dehydrogenase
Query= metacyc::MONOMER-15108 (486 letters) >NCBI__GCF_001584165.1:WP_061535235.1 Length = 491 Score = 355 bits (912), Expect = e-102 Identities = 187/448 (41%), Positives = 273/448 (60%), Gaps = 5/448 (1%) Query: 25 GKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKALN-GPWKKMTANERIAVLRKVGDL 83 G + ++ PAT E + + A+++ A+ A A W + +ER AVL +V L Sbjct: 20 GDRYASLYPATGEAVAWLNAASIADVEEAIAGADHAFRTSGWAQRKPHERAAVLYRVAQL 79 Query: 84 ILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHFFSDYIRTITNEATQMDDVALNYA 143 I ER E L+ + LD GKP + ++ + AA F FF+ T+ + T M L + Sbjct: 80 IRERSEYLAQRQRLDNGKPITETRAL-VASAAGTFQFFAAACETMEDTITPMRGDNLTMS 138 Query: 144 IRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVMKPAELTPMTATVLAEICRDAGVP 203 + P+GV+ I PWN P+ K+APALAAGN VV+KPAE+TP+ A LA IC +AGVP Sbjct: 139 VYEPMGVVAAITPWNSPIASEAQKMAPALAAGNAVVVKPAEVTPLMALELARICEEAGVP 198 Query: 204 DGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTGKIIMASAAKTLKRLSYELGGKNP 263 G+++++ G G + G A+T HP V +SFTG TTTGK I AA + +S ELGGK+P Sbjct: 199 KGLISVLPGKG-SVIGDAITLHPLVRRVSFTGGTTTGKHIAHIAADKMMPVSLELGGKSP 257 Query: 264 NVIFADSNLDEVIETTMKSSFINQGEVCLCGSRIYVERPAYEAFLEKFVAKTKELVVGDP 323 ++F D++LD + + F + GE C+ GSR++V YEAF+E+ A L VGDP Sbjct: 258 TMVFEDADLDHAVAGVLYGIFSSSGESCIAGSRLFVAHGIYEAFIERLAAGAAALRVGDP 317 Query: 324 FDAKTKVGALISDEHYERVTGYIKLAVEEGGTILTGGKRPEG--LEKGYFLEPTIITGLT 381 D +T++G LI+ H + + Y+ + V +GG I TGG RP G E+G + PTII GLT Sbjct: 318 ADERTQLGPLITPRHRDSIESYVAMGVADGGQIRTGGTRPTGALFERGNYYLPTIIEGLT 377 Query: 382 RDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGLSASVWTNDLRRAHRVAGQIEAGI 441 + R+ +EEIFGPV+ +PF+ EE+++ Q ND+ Y L+A +WT D ++A R ++AG Sbjct: 378 NEQRICQEEIFGPVLVAMPFENEEDLIAQANDSVYALAAGIWTRDYKKAWRFGRAVQAGN 437 Query: 442 VWVNTWFLRDLRTPFGGMKQSGIGREGG 469 VW+NT+ + TPFGG + SG+GRE G Sbjct: 438 VWINTYKQLSISTPFGGWRDSGLGREKG 465 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 601 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 491 Length adjustment: 34 Effective length of query: 452 Effective length of database: 457 Effective search space: 206564 Effective search space used: 206564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory