Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_061533629.1 CAter10_RS12280 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_001584165.1:WP_061533629.1 Length = 661 Score = 140 bits (353), Expect = 9e-38 Identities = 96/281 (34%), Positives = 153/281 (54%), Gaps = 15/281 (5%) Query: 21 LISVLVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAII 80 L+ +L + N +Y+ + + I I IL GL+++VG++GQ SLGHAG IG+Y ++ Sbjct: 14 LLLLLFPQVIPNPYYIHLAETILIYAILLFGLDIVVGYTGQVSLGHAGLFGIGSYTTGVL 73 Query: 81 GSKS--PTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIING 138 K P A +++V A+ +AL P LR+ G YLA+ TL II+I I Sbjct: 74 VFKLGWPFLIAAPASLVVTAIFGAILAL----PALRVTGPYLAMVTLAFGTIIQILINEM 129 Query: 139 GSLTNGAAGI-LGIPNFTTWQMV---YFFVV-----ITTIATLNFLRSPIGRSTLSVRED 189 LT+G GI L P+F +Q+ YF++V ++ I L+S +GR+ ++R+ Sbjct: 130 TFLTDGPMGIKLNKPSFFGYQLGDVGYFYLVAVLMVLSLIVVHRILKSHLGRAFQALRDS 189 Query: 190 EIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFG 249 IA++ +GV+ + K+ AFV A A +AGSL A + P Y F +I L+ V+ G Sbjct: 190 PIASDCMGVSVYRYKVYAFVISAALAGLAGSLYAYSEEYISPNTYNFELTILFLLAVIMG 249 Query: 250 GLGSITGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVM 290 G S G+++ A ++ +L LL D+ R I A+V V+ Sbjct: 250 GRKSRIGSLIGAFIVVMLPSLLADIDLFRQIATVAAVVAVL 290 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 661 Length adjustment: 33 Effective length of query: 285 Effective length of database: 628 Effective search space: 178980 Effective search space used: 178980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory