Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_061532831.1 CAter10_RS06900 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_001584165.1:WP_061532831.1 Length = 245 Score = 196 bits (498), Expect = 4e-55 Identities = 101/244 (41%), Positives = 161/244 (65%), Gaps = 3/244 (1%) Query: 1 MSGSAQNFTPLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFG 60 M+ + ++ P+L+V+++ Y ++ ++G++ + GE+ ++G NGAGKST I G Sbjct: 2 MAETNKHAAPILQVQDLAVSY-GHIEAVKGIDLVLNEGEITALVGANGAGKSTALLAISG 60 Query: 61 LLTPHTGKITFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQ 120 LL P G++ F G+++ L ++IV+ G+ V + +LS+ ENL +GA+ R D Sbjct: 61 LLKPQRGQVLFNGQDLTKLSPHKIVQSGVVQVAEGRATLTTLSIAENLALGAYTRKDKEN 120 Query: 121 PLKDK--IFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPIL 178 KD ++++FP L R+ AG LSGGE+QMLA+G+ALM +P +L+LDEPS L+P+L Sbjct: 121 IGKDLDWVYSLFPVLERRKDGLAGNLSGGEQQMLAIGRALMAKPRVLLLDEPSMGLAPLL 180 Query: 179 VTQVFEQVKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAE 238 V ++F V++IN+ G I+LVEQN R+AL +A GYVLE+G+ ++ G+ LL +PKV E Sbjct: 181 VQEIFRIVQEINRTGLTILLVEQNVRQALRIAQHGYVLENGKIVLADSGRNLLNNPKVLE 240 Query: 239 LYLG 242 YLG Sbjct: 241 AYLG 244 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 245 Length adjustment: 24 Effective length of query: 223 Effective length of database: 221 Effective search space: 49283 Effective search space used: 49283 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory