Align Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_061533691.1 CAter10_RS12710 sugar ABC transporter ATP-binding protein
Query= TCDB::G4FGN3 (494 letters) >NCBI__GCF_001584165.1:WP_061533691.1 Length = 516 Score = 354 bits (909), Expect = e-102 Identities = 209/497 (42%), Positives = 307/497 (61%), Gaps = 8/497 (1%) Query: 3 PILEVKSIHKRFPGVHALKGVSMEFYPGEVHAIVGENGAGKSTLMKIIAGVYQPDEGEII 62 P LE+ I+K F GV AL VS+ YPGEVH ++G+NGAGKSTL+K++ GV+ P+ G I Sbjct: 18 PTLELNGIYKAFGGVKALSDVSLRLYPGEVHTLMGQNGAGKSTLIKVLTGVHIPEHGTIR 77 Query: 63 YEGRGVRWNHPSEAINAGIVTVFQELSVMDNLSVAENIFMGDEEKRGIFIDYKKMYREAE 122 GR VR EA + GI TV+QE+++ NLSVAENIF+G + ID+K M R+A+ Sbjct: 78 LNGREVRPTSTLEAQHLGISTVYQEVNLCPNLSVAENIFIGRYPTKFGAIDWKTMQRQAQ 137 Query: 123 KFMKEEFGIEIDPEEKLGKYSIAIQQMVEIARAVYKKAKVLILDEPTSSLTQKETEKLFE 182 + + + I+ID L +Y +AIQQMV I+RA+ AKVLILDEPTSSL + E + LF Sbjct: 138 RLL-GDLQIDIDVTAPLSRYPLAIQQMVAISRALSVSAKVLILDEPTSSLDEAEVQLLFS 196 Query: 183 VVKSLKEKGVAIIFISHRLEEIFEICDKVSVLRDGEYIGTDSIENLTKEKIVEMMVGRKL 242 V++ L+E+G+AI+F++H LE+ ++I D+++VLR+G G ++ LT+ ++V MVG ++ Sbjct: 197 VLRKLREQGMAILFVTHFLEQTYDISDRITVLRNGVLEGEYRVDELTRLELVNKMVGSQM 256 Query: 243 E-KFYIKEA----HEPGEVVLEVKNLSGER-FENVSFSLRRGEILGFAGLVGAGRTELME 296 + + +A + E+VL+ + L + + LR GE+ G GL+G+GRTE Sbjct: 257 QSEVQAPDAATGLRDNAEIVLQARGLGRKGILAPLDLDLRAGEVYGLCGLLGSGRTETAR 316 Query: 297 TIFGFRPKRGGEIYIEGKRV-EINHPLDAIEQGIGLVPEDRKKLGLILIMSIMHNVSLPS 355 +FG G I I+ K + + P +AI GIG EDRK+ G IL +S+ N+ L Sbjct: 317 LLFGADKADSGAISIKDKPLGKFGSPREAIAAGIGFCSEDRKQEGAILELSVRENIILGL 376 Query: 356 LDRIKKGPFISFKREKELADWAIKTFDIRPAYPDRKVLYLSGGNQQKVVLAKWLALKPKI 415 R I KR++ +A +K I+ + + LSGGNQQK +LA+WLA P I Sbjct: 377 QARAGLLRVIPRKRQQAIAADYVKWLGIKTPDIETPISSLSGGNQQKALLARWLATDPVI 436 Query: 416 LILDEPTRGIDVGAKAEIYRIMSQLAKEGVGVIMISSELPEVLQMSDRIAVMSFGKLAGI 475 LILDEPTRGIDV AK EI + L ++G+ ++ ISSE+ EVL+ SDR+ V+ + G Sbjct: 437 LILDEPTRGIDVRAKQEIMDHVIALCRKGMAILFISSEISEVLRCSDRMLVLRDREPCGE 496 Query: 476 IDAKEASQEKVMKLAAG 492 E + V+++ AG Sbjct: 497 YLRGELDDDSVLQVIAG 513 Lambda K H 0.318 0.138 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 620 Number of extensions: 31 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 516 Length adjustment: 34 Effective length of query: 460 Effective length of database: 482 Effective search space: 221720 Effective search space used: 221720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory