Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_061942438.1 CPter91_RS17560 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_001584185.1:WP_061942438.1 Length = 256 Score = 185 bits (469), Expect = 9e-52 Identities = 104/249 (41%), Positives = 151/249 (60%), Gaps = 4/249 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 IL + V KRFGGLQALS+VN+ + + ++ +IGPNGAGK+T N + G DTGS Sbjct: 6 ILNISGVNKRFGGLQALSEVNVKILKGQIYGLIGPNGAGKTTFFNVITGLYQADTGSFEL 65 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAK-RDGAF--EMNAISAV 119 GK AP+E+ + GI+R FQ +FG+++VLEN+M+ C + G F +A Sbjct: 66 AGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTHQGVFGAVFRHKAAR 125 Query: 120 SGQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGM 179 + + I ++++ +L+ + + A +S GD+RRLEI L+ EP+LL LDEP AGM Sbjct: 126 TEELAIRKRSQELLDFVGIGRFGERTARHLSYGDQRRLEIARALATEPQLLALDEPAAGM 185 Query: 180 ARADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGN 239 + +LL +IK+E TI +IEHD+ ++ L DR+TVL G P+ E P I+ N Sbjct: 186 NATEKLALRELLVKIKNEGK-TILLIEHDVKLMMGLCDRLTVLDYGKPIAEGLPAEIQKN 244 Query: 240 PKVREAYLG 248 P V EAYLG Sbjct: 245 PAVIEAYLG 253 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 256 Length adjustment: 24 Effective length of query: 227 Effective length of database: 232 Effective search space: 52664 Effective search space used: 52664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory