Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate WP_061941787.1 CPter91_RS15495 carbohydrate ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >NCBI__GCF_001584185.1:WP_061941787.1 Length = 301 Score = 169 bits (428), Expect = 7e-47 Identities = 91/285 (31%), Positives = 154/285 (54%), Gaps = 4/285 (1%) Query: 25 PAPPQKEKKEGTVLNVFSHGILVLWAFMVVLPLLWAVMTSFKDDASIFGSPWSLP--DKL 82 P P + + ++ H +L +A + + P+ ++ S K +IF +P + P D Sbjct: 19 PVPLFARSRFANLGRIWVHVVLCAYAVIALFPIALILINSVKSRDAIFDNPLAFPTPDSF 78 Query: 83 HFDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIG 142 + + + YF N+++V GSL+ ++ G+MA + L+ + F GNR + Sbjct: 79 SLIGFEKVLHNTNFMLYFGNSLVVTLGSLVLIVLFGAMAGWALSEYKFRGNRLMALYLAL 138 Query: 143 GMSFPIMLALVPLFYVVNNMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAA 202 G+ PI L V + +V ++ L+NT LILVY A LP V L+ F R +P + +AA Sbjct: 139 GIMIPIRLGTVSILQLVVSLDLINTRTALILVYTAQGLPLAVMILSEFIRQIPKELKDAA 198 Query: 203 FVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQL 262 DG + FFQI+LP+ +P + +V +F + WN P +L + + +T G VQ Sbjct: 199 RCDGVGEFKIFFQIILPLIRPAIATVAVFTMIPAWNDLWFPLILAPSDETKTVTLG-VQQ 257 Query: 263 AVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQGLTAGALK 307 + Q Y DW+ + A L +A++P+L Y+IF RQ+++GLT+GA+K Sbjct: 258 FIGQ-YVTDWNSVLAALSLAVIPILIMYVIFSRQLIRGLTSGAVK 301 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 301 Length adjustment: 27 Effective length of query: 280 Effective length of database: 274 Effective search space: 76720 Effective search space used: 76720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory