Align Xylose/arabinose import permease protein XacH (characterized, see rationale)
to candidate WP_167595232.1 CPter91_RS16310 ABC transporter permease subunit
Query= uniprot:D4GP36 (317 letters) >NCBI__GCF_001584185.1:WP_167595232.1 Length = 292 Score = 157 bits (396), Expect = 4e-43 Identities = 98/275 (35%), Positives = 144/275 (52%), Gaps = 7/275 (2%) Query: 42 PFVLMSIA-VYGGTGYNFAISFTDYEGLGTPDYSTLDLEMYAQALSSDAFIAAAQNNLVL 100 P +++S+ VYG G +S T+ L P+Y Y + D + AA N + Sbjct: 16 PTIILSLVFVYGFIGVTAWLSLTNSRML--PNYEISGFNQYVELFGLDRWWVAAANLGIF 73 Query: 101 LVGFTTICLVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILN 160 F CL +GLF+AILLD IR + +YL PM+LSF+VT W W+ N G L Sbjct: 74 GGLFILFCLAIGLFMAILLDQKIRAEGALRAIYLYPMALSFIVTGAAWKWILNPGLG-LE 132 Query: 161 LVVTTLGFNPV--DWLGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAARVD 218 ++ GF DWL N ++ V++A +WQ SG+ M ++LAGL+ I D +AA VD Sbjct: 133 KMMHDWGFANFHFDWLVNSDFSIYTVVIAGVWQSSGFVMALFLAGLRGIDDSIIKAAMVD 192 Query: 219 GASITRTYLRIIVPQLKEASVSAAVVLMVFALKAFTFLYALVGRYRPPNGTDILATLMVR 278 GAS+ Y RI++P L+ S +VL A+K+F + AL P +D+ A M + Sbjct: 193 GASLPTIYRRIVIPALRPVFFSVLLVLAHIAIKSFDLVMALTAG-GPGTSSDLPAIFMYQ 251 Query: 279 RAFKFGEWAYSAAIATMLLIMALGVIGPYLYYQYK 313 +F G+ AA A M+L L V+ P +Y + K Sbjct: 252 FSFSRGQLGLGAASAMMMLATVLAVLVPMMYLETK 286 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 292 Length adjustment: 27 Effective length of query: 290 Effective length of database: 265 Effective search space: 76850 Effective search space used: 76850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory