Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_061942033.1 CPter91_RS16320 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_001584185.1:WP_061942033.1 Length = 380 Score = 264 bits (675), Expect = 3e-75 Identities = 165/359 (45%), Positives = 208/359 (57%), Gaps = 23/359 (6%) Query: 22 LSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIGGDHMNYRVPQNRDIAMVF 81 + L+I+D +FL+LVG SGCGKST L M+AGLET + G I IG +N P+ RDIAMVF Sbjct: 23 IDLEIEDGQFLILVGGSGCGKSTLLNMIAGLETVSEGQIMIGDRCVNDVPPKERDIAMVF 82 Query: 82 QDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETLGIADLLDRKPDELSGGQQQ 141 Q YALYP MTVR+NI FGL + AE+ + V VA TL I LLDRKP LSGGQ+Q Sbjct: 83 QSYALYPTMTVRENISFGLGIRK-VPKAEQKQIVERVANTLQITHLLDRKPALLSGGQRQ 141 Query: 142 RVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQDQLAVTTVYVTHNQTEAMTM 201 RVA+GRAI RDP +FL DEPLSNLDAKLR EMR E++ + +L T VYVTH+Q EAMT+ Sbjct: 142 RVAMGRAIARDPSLFLFDEPLSNLDAKLRVEMRAEIKLMHQRLGSTIVYVTHDQIEAMTL 201 Query: 202 ADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMINLVRGT--------RSESTFV 253 DRIAVM DG +QQ SP E Y P+NLFVA FIG P +N +RG E T Sbjct: 202 GDRIAVMKDGVVQQFGSPQEIYDNPSNLFVAGFIGSPSMNFMRGNLVANGHGPAFELTHG 261 Query: 254 GEHFSYPLDEDVMESVDDR----DDFVLGVRPEDIEVADAAPDDAALDD---HDLQMDVT 306 G PL + + + +LG+RPE + A +A A D H ++ T Sbjct: 262 GRTTLLPLAPAQAQRPEIAAWVGKEVILGIRPEHVTDAQSARTSEAAGDSNYHPTEVGCT 321 Query: 307 V--VEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDKIHLFDAET 363 V EP G ++ + + + T D + + K LFDA+T Sbjct: 322 VELTEPTGPDTLVFTTFNEA-----RVTCRTHPRAAAKPKDEMQLAFDLSKAVLFDAKT 375 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 380 Length adjustment: 30 Effective length of query: 353 Effective length of database: 350 Effective search space: 123550 Effective search space used: 123550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory