Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_061942033.1 CPter91_RS16320 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_001584185.1:WP_061942033.1 Length = 380 Score = 296 bits (757), Expect = 8e-85 Identities = 179/389 (46%), Positives = 240/389 (61%), Gaps = 33/389 (8%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA L++ +V KVY + G +++ + I L+I+DG+FL+LVG SGCGKST L M+AGLETV Sbjct: 1 MASLSIRNVRKVYPN--GNEVL--KGIDLEIEDGQFLILVGGSGCGKSTLLNMIAGLETV 56 Query: 61 TEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRV 120 +EG++ + DR +N V ++RDIAMVFQSYALYP +VR N+SFGL +P E +Q V Sbjct: 57 SEGQIMIGDRCVNDVPPKERDIAMVFQSYALYPTMTVRENISFGLGIRK-VPKAEQKQIV 115 Query: 121 EETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRT 180 E + L I+ LLDRKP LSGGQ+QRVA+GRAI RDP +FL DEPLSNLDAKLR EMR Sbjct: 116 ERVANTLQITHLLDRKPALLSGGQRQRVAMGRAIARDPSLFLFDEPLSNLDAKLRVEMRA 175 Query: 181 ELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFI 240 E++ + LG T VYVTHDQ EAMT+GDR+AV+ DG +QQ G+P + Y P+NLFVAGFI Sbjct: 176 EIKLMHQRLGSTIVYVTHDQIEAMTLGDRIAVMKDGVVQQFGSPQEIYDNPSNLFVAGFI 235 Query: 241 GEPSMNLFDGSLSGDTFRGDGFDYPLSGAT-----------RDQLGGASG--LTLGIRPE 287 G PSMN G+L + G F+ G T R ++ G + LGIRPE Sbjct: 236 GSPSMNFMRGNLVANG-HGPAFELTHGGRTTLLPLAPAQAQRPEIAAWVGKEVILGIRPE 294 Query: 288 DVTVGE-RRSGQRTFDAE---------VVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQ 337 VT + R+ + D+ V + EP G + V F + + T T + Sbjct: 295 HVTDAQSARTSEAAGDSNYHPTEVGCTVELTEPTGPDTLVFTTFNE----ARVTCRTHPR 350 Query: 338 SRVEAGDRTTVSFPEDAIHLFDGETGDAL 366 + + D ++F LFD +T + + Sbjct: 351 AAAKPKDEMQLAFDLSKAVLFDAKTEERI 379 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 31 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 380 Length adjustment: 30 Effective length of query: 353 Effective length of database: 350 Effective search space: 123550 Effective search space used: 123550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory