Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_061945227.1 CPter91_RS24210 carbohydrate ABC transporter permease
Query= uniprot:A8LLL4 (385 letters) >NCBI__GCF_001584185.1:WP_061945227.1 Length = 283 Score = 122 bits (306), Expect = 1e-32 Identities = 65/212 (30%), Positives = 113/212 (53%), Gaps = 2/212 (0%) Query: 174 MARAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPL 233 + R N+L +T+P I + ++ + +AL F L+ L VG VP Q+ ++P+ Sbjct: 73 LTRYIVNSLLITVPVVIGAVALSCLSGFALGIYRFRLNLLVFFLFVGGNFVPFQILMVPV 132 Query: 234 LTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFTK 293 L +G+ LG L HT F + +RN++ LP ++I+ A+++GA++F++F K Sbjct: 133 RDLSLRLGLYDSILGLVLFHTAFQAGFCTFFMRNFIRDLPFELIDAARIEGASEFEVFWK 192 Query: 294 IVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGGNWEIL 353 IVLPL PA+A+ ++ F + WND A V + +T + L G W ++ Sbjct: 193 IVLPLVRPAIAAVSVLIFTFVWNDYFWATVLI--QGDHAMPVTAGLKSLNGQWVAQWNLV 250 Query: 354 ATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 + + ++ P+LVFF MQ+ + GL G+ K Sbjct: 251 SAGSIIAALPPVLVFFLMQKHFIAGLTMGATK 282 Score = 28.9 bits (63), Expect = 2e-04 Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 11 LTWAVQLSVVGLVVLWLLPTFGLFVSSFRTVEQISSSGWW 50 L W ++ V+ + +WLLP + ++S R I++ +W Sbjct: 13 LQWLYRVCVLLALSIWLLPLVAVALTSVRGAADINAGNYW 52 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 385 Length of database: 283 Length adjustment: 28 Effective length of query: 357 Effective length of database: 255 Effective search space: 91035 Effective search space used: 91035 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory