Align KguT (characterized, see rationale)
to candidate WP_099047313.1 CPter91_RS19920 MFS transporter
Query= uniprot:A0A167V864 (425 letters) >NCBI__GCF_001584185.1:WP_099047313.1 Length = 436 Score = 213 bits (543), Expect = 7e-60 Identities = 127/424 (29%), Positives = 216/424 (50%), Gaps = 10/424 (2%) Query: 2 QIDRLAPRRWWYIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLG 61 Q + L + +W +P + + Y +AYLDR N GFA M+ DL + + L +FFLG Sbjct: 16 QAENLYKKVFWRFVPFIMLCYVVAYLDRVNVGFAKLQ-MSQDLGFSETIFGLGAGIFFLG 74 Query: 62 YFFFQVPGAIYAEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMP 121 YF F++P + + K I +I WG L+ VQ+ + +RFLLGV EA P Sbjct: 75 YFLFELPSNLIMNRVGAKLWIARIMITWGVLSACFAWVQTPTQFYVLRFLLGVAEAGFYP 134 Query: 122 AMLIYLCHWFTRAERSRANTFLILGNPVTILWMSVVSGYLVKHFD-------WRWMFIIE 174 +++YL +WF R++ + P++ ++ + +SG++++ F W+WMF+IE Sbjct: 135 GIILYLTYWFPSHRRAKVVATFMAAIPISGIFGNPLSGWIMQAFHGASGWHGWQWMFMIE 194 Query: 175 GLPAVLWAFIWWRLVDDRPEQASWLKAQEKTALREALAAEQQGIKPVKNYREAFRSPKVI 234 +PAVL + ++D+ +A WL EK L + A+Q+ K F+ ++ Sbjct: 195 AVPAVLVGIAVFFVMDNSIRKAKWLTEAEKDFLEAEIRADQKDKHSPKTTAAVFKDIRIW 254 Query: 235 ILSLQYFCWSIGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRM 294 + L YFC +G YG WLP+++K + + G +SA+P+L AV AM+ + SDR+ Sbjct: 255 HMCLIYFCIVMGQYGLTFWLPTLVKASGVVGDFKIGLISAIPFLCAVFAMILIGRRSDRL 314 Query: 295 QKRKRFVWPPLLIAALAFYGSYILGTEHFWWSYTLLVIAGACMYAPYGPFFAIVPELLPS 354 ++R+ + P L+ A+ F S L ++ + L +A + F+++ L Sbjct: 315 RERRWHLIVPALLGAVGFVVS-ALAADNTVIAIAFLSLAAMGVLTCSPLFWSLPTAFLSG 373 Query: 355 NVAGGAMALINSMGALGSFSGSWLVGYLNGVTGGPGASYLFMCGALLVAVALTAVLNPSQ 414 A +A+INS+G L F +LVG+L T + +FM +LV A+ + P + Sbjct: 374 TGAAAGIAVINSVGNLAGFVSPFLVGWLKDTTHN-NRTGMFMLAGMLVIGAIAILKTPPK 432 Query: 415 QARR 418 R Sbjct: 433 MVNR 436 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 436 Length adjustment: 32 Effective length of query: 393 Effective length of database: 404 Effective search space: 158772 Effective search space used: 158772 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory