Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_061945227.1 CPter91_RS24210 carbohydrate ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >NCBI__GCF_001584185.1:WP_061945227.1 Length = 283 Score = 139 bits (350), Expect = 7e-38 Identities = 84/271 (30%), Positives = 147/271 (54%), Gaps = 12/271 (4%) Query: 23 IILAILVVLTLGPIVFMVLTSLMDHNAIARGK-WIAPTRFS---NYVEVFQKLPFGIYFR 78 ++LA+ + L P+V + LTS+ I G W P ++ NY VF P Y Sbjct: 21 VLLALSIWLL--PLVAVALTSVRGAADINAGNYWGWPAQWQIAENYRAVFSNTPLTRYIV 78 Query: 79 NSLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPLYLDFVK 138 NSL++ V++ A+ ++ L+G++L Y+F + L + +P + ++P+ Sbjct: 79 NSLLITVPVVIGAVALSCLSGFALGIYRFRLNLLVFFLFVGGNFVPFQILMVPVR----- 133 Query: 139 IKQATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNKFTAFLR 198 + + L +SI GLV+ ++AF F + +R F +P EL +AARI+G ++F F + Sbjct: 134 -DLSLRLGLYDSILGLVLFHTAFQAGFCTFFMRNFIRDLPFELIDAARIEGASEFEVFWK 192 Query: 199 VMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIAYTTARYDLLMA 258 ++LPL P I A ++ IF W++ +A VL++ + AG++ A+++L+ A Sbjct: 193 IVLPLVRPAIAAVSVLIFTFVWNDYFWATVLIQGDHAMPVTAGLKSLNGQWVAQWNLVSA 252 Query: 259 AGTIVTIPVLIMFFTMQKKFISGMTAGAVKG 289 I +P +++FF MQK FI+G+T GA KG Sbjct: 253 GSIIAALPPVLVFFLMQKHFIAGLTMGATKG 283 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 283 Length adjustment: 26 Effective length of query: 263 Effective length of database: 257 Effective search space: 67591 Effective search space used: 67591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory