Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_061942033.1 CPter91_RS16320 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_001584185.1:WP_061942033.1 Length = 380 Score = 322 bits (825), Expect = 1e-92 Identities = 185/375 (49%), Positives = 245/375 (65%), Gaps = 16/375 (4%) Query: 1 MAPVTLKKLVKRY-GALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGA 59 MA ++++ + K Y EV+ GIDLE++D +F+ LVG SGCGKST L MIAGLE VS G Sbjct: 1 MASLSIRNVRKVYPNGNEVLKGIDLEIEDGQFLILVGGSGCGKSTLLNMIAGLETVSEGQ 60 Query: 60 IEIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAA 119 I IG R VND+PP+ R+I+MVFQSYALYP MTV EN+ F L I P E K V A Sbjct: 61 IMIGDRCVNDVPPKERDIAMVFQSYALYPTMTVRENISFGLGIRKVPKAEQKQIVERVAN 120 Query: 120 ILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKL 179 L + HLL+R+P+ LSGGQRQRVAMGRAI R P +FLFDEPLSNLDAKLR ++R EIK + Sbjct: 121 TLQITHLLDRKPALLSGGQRQRVAMGRAIARDPSLFLFDEPLSNLDAKLRVEMRAEIKLM 180 Query: 180 HARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPM 239 H R+ +T++YVTHDQ+EAMTL DRI +M+DG ++Q G+P++++ P+ FVAGFIGSP M Sbjct: 181 HQRLGSTIVYVTHDQIEAMTLGDRIAVMKDGVVQQFGSPQEIYDNPSNLFVAGFIGSPSM 240 Query: 240 N-MEEAVLTDG-----KLAFASGAT-LPLPP----RFRSLVREGQKVTFGLRPD---DVY 285 N M ++ +G +L T LPL P R G++V G+RP+ D Sbjct: 241 NFMRGNLVANGHGPAFELTHGGRTTLLPLAPAQAQRPEIAAWVGKEVILGIRPEHVTDAQ 300 Query: 286 PSGHGLHAGDAD-AVHEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPLRPGEAVP 344 + AGD++ E+ V +TEP G +TLVFT FN R +P + + Sbjct: 301 SARTSEAAGDSNYHPTEVGCTVELTEPTGPDTLVFTTFNEARVTCRTHPRAAAKPKDEMQ 360 Query: 345 MSFDLARAHLFDGET 359 ++FDL++A LFD +T Sbjct: 361 LAFDLSKAVLFDAKT 375 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 380 Length adjustment: 30 Effective length of query: 335 Effective length of database: 350 Effective search space: 117250 Effective search space used: 117250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory