Align ABC transporter for D-Galactose and D-Glucose, permease component 1 (characterized)
to candidate WP_167595232.1 CPter91_RS16310 ABC transporter permease subunit
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1895 (302 letters) >NCBI__GCF_001584185.1:WP_167595232.1 Length = 292 Score = 387 bits (995), Expect = e-112 Identities = 181/283 (63%), Positives = 229/283 (80%) Query: 19 WLPKLVLAPSMLIVLVGFYGYIIWTFILSFTNSSFMPSYKWVGLQQYMRLMDNDRWWVAS 78 WLP+LVL+P++++ LV YG+I T LS TNS +P+Y+ G QY+ L DRWWVA+ Sbjct: 8 WLPRLVLSPTIILSLVFVYGFIGVTAWLSLTNSRMLPNYEISGFNQYVELFGLDRWWVAA 67 Query: 79 KNLALFGGMFISISLVLGVFLAVLLDQRIRKEGFIRTVYLYPMALSMIVTGTAWKWLLNP 138 NL +FGG+FI L +G+F+A+LLDQ+IR EG +R +YLYPMALS IVTG AWKW+LNP Sbjct: 68 ANLGIFGGLFILFCLAIGLFMAILLDQKIRAEGALRAIYLYPMALSFIVTGAAWKWILNP 127 Query: 139 GLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGFVMAMFLAGLRGVDQSIIR 198 GLGL+KM+ DWG+ F DWLV+ D +Y +VIA VWQ+SGFVMA+FLAGLRG+D SII+ Sbjct: 128 GLGLEKMMHDWGFANFHFDWLVNSDFSIYTVVIAGVWQSSGFVMALFLAGLRGIDDSIIK 187 Query: 199 AAQVDGASLPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDLVAAMTAGGPGYSSDLPAM 258 AA VDGASLPTIY +IV+P+LRPVFFS ++LAHIAIKSFDLV A+TAGGPG SSDLPA+ Sbjct: 188 AAMVDGASLPTIYRRIVIPALRPVFFSVLLVLAHIAIKSFDLVMALTAGGPGTSSDLPAI 247 Query: 259 FMYSFTFSRGQMGIGSASAMLMLGAVLTILVPYLYSELRGKRH 301 FMY F+FSRGQ+G+G+ASAM+ML VL +LVP +Y E +G R+ Sbjct: 248 FMYQFSFSRGQLGLGAASAMMMLATVLAVLVPMMYLETKGARN 290 Lambda K H 0.329 0.141 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 292 Length adjustment: 26 Effective length of query: 276 Effective length of database: 266 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory