Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_061942552.1 CPter91_RS17900 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_001584185.1:WP_061942552.1 Length = 359 Score = 333 bits (855), Expect = 3e-96 Identities = 177/370 (47%), Positives = 244/370 (65%), Gaps = 13/370 (3%) Query: 1 MATLELRNVNKTYG--PGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETIS 58 MA + L+NV KTYG P D + I + I DGEF+++VGPSGCGKSTL+ +AGLE +S Sbjct: 1 MAQVHLKNVKKTYGKAPKAVDVIHGISIDIADGEFIVMVGPSGCGKSTLLRMVAGLEEVS 60 Query: 59 GGAILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVAR 118 G I++ + ++ + PKDRDIAMVFQ+YALYP MSV +N+A+GLKIR + +I+ V + Sbjct: 61 AGDIVIGERVVNQLEPKDRDIAMVFQNYALYPHMSVYENMAYGLKIRGLSKDDIETRVQK 120 Query: 119 VSKLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEM 178 +K+L++ LL R P QLSGGQ+QRVAMGRA+ R P ++LFDEPLSNLDAKLRV+MR E+ Sbjct: 121 AAKILELGALLQRTPRQLSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQMRLEI 180 Query: 179 KLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGS 238 + +H+ L TT++YVTHDQ+EAMTLG ++ VM G +Q GTP ++Y PA FVASFIGS Sbjct: 181 QKLHRTLGTTSLYVTHDQVEAMTLGQRMIVMNGGRAEQIGTPAEVYARPATTFVASFIGS 240 Query: 239 PPMNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGEA 298 PPMN + R+ DG A+ A LP + R+ I+G+RPEQ+I Sbjct: 241 PPMNLLCGRV-AADGNSFAI--DNAAAVSLPFSCHP--IAGRDCIMGLRPEQLIF----- 290 Query: 299 NGLPTIRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPAVGETLTLQFDPAKVLLFD 358 G P + ++ E G D LV V++ D + R+ A G+ +T FD A + FD Sbjct: 291 -GQPGLNLRAELVEALGADLLVHVSIGDQLLVMRVPAATAVEAGQQITAGFDAAALHWFD 349 Query: 359 AKTGERLGVA 368 +T +R+ +A Sbjct: 350 PETTQRIELA 359 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 359 Length adjustment: 30 Effective length of query: 356 Effective length of database: 329 Effective search space: 117124 Effective search space used: 117124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory