Align 2-dehydro-3-deoxyglucono/galactono-kinase (EC 2.7.1.178) (characterized)
to candidate WP_061942382.1 CPter91_RS17385 sugar kinase
Query= BRENDA::Q97U29 (313 letters) >NCBI__GCF_001584185.1:WP_061942382.1 Length = 306 Score = 135 bits (341), Expect = 9e-37 Identities = 87/276 (31%), Positives = 135/276 (48%), Gaps = 14/276 (5%) Query: 2 VDVIALGEPLIQFNSFNPGPLRFVNYFEKHVAGSELNFCIAVVRNHLSCSLIARVGNDEF 61 +D++A GE +++FN ++ F G NFCIA R I+ +GND F Sbjct: 3 IDILAYGEAMVEFNQRQHDTRMYLQGF----GGDTSNFCIAAARQGARSGYISALGNDHF 58 Query: 62 GKNIIEYSRAQGIDTSHIKVDNESFTGIYFIQRGYPIPMKSELVYYRKGSAGSRLSPEDI 121 G+ + +A+ +D SH+ D + TG+YF+ Y R GSA SR S E + Sbjct: 59 GEQLRALWQAEQVDASHVARDANAATGVYFVSHDQD---GHHFDYLRAGSAASRYSSEQL 115 Query: 122 NENYVRNSRLVHSTGITLAISDNAKEAVIKAFELAKSR----SLDTNIRPKLWSSLEKAK 177 + ++++H +GI+LAIS +A +A + A A+ SLDTN+R KLW LE+A+ Sbjct: 116 PLAAIAAAKVLHLSGISLAISASACDAGLAAMAYARKHGVKTSLDTNLRLKLW-PLERAQ 174 Query: 178 ETILSILKKYDIEVLITDPDDTKILLDVTDPDEAYRKYKELGVKVLLYKLGSKGAIAYKD 237 E I + DI + DD L + D D + G+ ++ +KLG++G Sbjct: 175 EKIRAAFALCDI--CLPSWDDISALTSLDDRDAIVDELLSYGIGLIAFKLGAEGCYVATA 232 Query: 238 NVKAFKDAYKVPVEDPTGAGDAMAGTFVSLYLQGKD 273 + Y V D TGAGD G F++ + G D Sbjct: 233 KERRLVPPYSVEAIDATGAGDCFGGAFIARIVAGDD 268 Lambda K H 0.317 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 306 Length adjustment: 27 Effective length of query: 286 Effective length of database: 279 Effective search space: 79794 Effective search space used: 79794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory