Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate WP_061937245.1 CPter91_RS04060 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:Q888H2 (294 letters) >NCBI__GCF_001584185.1:WP_061937245.1 Length = 296 Score = 214 bits (546), Expect = 1e-60 Identities = 123/276 (44%), Positives = 163/276 (59%), Gaps = 10/276 (3%) Query: 14 GESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADSRGGWIAGMENG 73 GESPVWS REQ LYWVDI LHR+D + + RSW AP + I+ G + + +G Sbjct: 20 GESPVWSQREQVLYWVDILKPALHRFDPASGQQRSWTAPAAIGSISLARNGKIVTALRSG 79 Query: 74 LYHLQPCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTMLMDMAAGAVVGALYR 133 + P D TL+A E + R NDG+ G FWAGTM D A +LYR Sbjct: 80 FHWFDPADASW---TLIAHPEPHISHNRLNDGKTGPDGAFWAGTM-DDRADKQPCASLYR 135 Query: 134 YSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFDYDTDSGTPHDRRLF 193 A ++ A L+V NGLA+SPDG+TMY SDS AV I+ +D+D SG R++F Sbjct: 136 L-APDGSISAHGNGLVVSNGLAWSPDGRTMYHSDSRRAV--IYRYDFDAASGALGPRQVF 192 Query: 194 VDMNNYLGRPDGAAIDADGCYWICGNDAGLVHRFTPNGKLDRSLVVPVKKPAMCAFGGPN 253 V M GRPDG AIDA+G YW CG AG +++F+P G+L L +PV +P MCAFGG + Sbjct: 193 VQMQPEWGRPDGGAIDAEGNYWGCGITAGRINKFSPQGQLLGYLPLPVSRPTMCAFGGAD 252 Query: 254 LDTLFVTSI---RPGGDLSDQPLAGGVFALRPGVKG 286 L TL++TS+ +L+ +PLAG +FA+ V G Sbjct: 253 LKTLYITSLTENMSAEELAREPLAGALFAVDMPVAG 288 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 296 Length adjustment: 26 Effective length of query: 268 Effective length of database: 270 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory