Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_061945612.1 CPter91_RS25350 ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_001584185.1:WP_061945612.1 Length = 362 Score = 166 bits (419), Expect = 8e-46 Identities = 103/250 (41%), Positives = 151/250 (60%), Gaps = 14/250 (5%) Query: 16 LEIRDLHKQYGP----LEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQ 71 L + +LH YG +LKGV + +QRG VV L+G SGSGKTTLLR V LE + G Sbjct: 4 LSVNNLHLDYGSGASANPILKGVSMELQRGEVVALLGPSGSGKTTLLRAVAGLESPKSGS 63 Query: 72 ILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKK 131 I + GE I + +G+R ++ A+ R + G+ FQ + L+PH T NV GL K++K Sbjct: 64 IQI-GERIMF---DGQR---KLEIPAEERNL-GLVFQSYALWPHKTVSDNVGYGL-KLRK 114 Query: 132 LHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSAL 191 + + + L ++GL D +P QLSGGQQQRVAIARA+ NP ++L DE S L Sbjct: 115 MSSSDIATRVKTVLGQLGLGHLGDRFPHQLSGGQQQRVAIARALVYNPPVILLDEPLSNL 174 Query: 192 DPELVGEVLSVIKGL-AEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFER 250 D +L E + ++ L G++ L+VTH+ A +SD+I+ +N G+IE+QG P+ ++E Sbjct: 175 DAKLREEARAFLRELIVRLGLSALMVTHDQAEAMAISDRILLLNNGKIEQQGTPQSMYET 234 Query: 251 PQSPRLAEFL 260 P + AEF+ Sbjct: 235 PDTLFTAEFM 244 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 362 Length adjustment: 27 Effective length of query: 238 Effective length of database: 335 Effective search space: 79730 Effective search space used: 79730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory