Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_061939852.1 CPter91_RS10210 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_001584185.1:WP_061939852.1 Length = 363 Score = 291 bits (746), Expect = 1e-83 Identities = 159/362 (43%), Positives = 227/362 (62%), Gaps = 8/362 (2%) Query: 1 MSALEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDI 60 M+++ + K Y + + + EF+VLLG SGCGKST+L ++AGL E SGG + Sbjct: 1 MASIVCDKLVKHYEGNPVVHDFSMEIADAEFIVLLGPSGCGKSTILRMMAGLEEISGGAL 60 Query: 61 LIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARL 120 IG R V + P++RDIAMVFQ+Y LYP+++V N+ FGL + P++E + V A++ Sbjct: 61 HIGARQVNDLPPRERDIAMVFQNYVLYPHMTVYDNMAFGLRRLKTPESEISQRVGQVAQM 120 Query: 121 LQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLH 180 L +E LL RKP Q+SGGQ+QRVAIGRA+++ P VFLFDEPLSNLDAKLR ++R ++KRLH Sbjct: 121 LSLEPLLQRKPKQMSGGQQQRVAIGRAMIKTPAVFLFDEPLSNLDAKLRAQLRGDIKRLH 180 Query: 181 QMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMN 240 + L TT VYVTHDQ+EAMTLA RI +++ GRIEQ+ P E+Y+ P + + AGF+G+P MN Sbjct: 181 RQLATTSVYVTHDQLEAMTLADRIVLLKAGRIEQVGTPAEIYNHPVSRFAAGFIGTPAMN 240 Query: 241 ILDAEMT-ANGLKIEGCEEV---LPLPAAFNGAAWAGRRVKVGIRPEAL-RLAAGSEAQR 295 + + +G+ + E LP P+ F A G+ V +G+RP + + G Sbjct: 241 FIGCVASHEDGMTVLDSGEARWRLP-PSLF--AVSEGQSVVLGVRPNHMFTTSVGDRQIE 297 Query: 296 LTASVEVVELTGPELVTTATVGSQRITACLPPRTAVGMGSAHAFTFDGTALHLFDPESGR 355 + V++VEL G E + + ITA +P +G F LH+FD E+G Sbjct: 298 VRGKVDLVELLGAESLVSLLHAKHEITALVPANRCPRVGDQVCFNISLNDLHVFDAETGS 357 Query: 356 SL 357 SL Sbjct: 358 SL 359 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 363 Length adjustment: 29 Effective length of query: 331 Effective length of database: 334 Effective search space: 110554 Effective search space used: 110554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory