Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate WP_061941787.1 CPter91_RS15495 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc02871 (279 letters) >NCBI__GCF_001584185.1:WP_061941787.1 Length = 301 Score = 372 bits (956), Expect = e-108 Identities = 187/278 (67%), Positives = 232/278 (83%), Gaps = 2/278 (0%) Query: 4 ARASFMRTGA--VHAALIAYTLIALFPVFLTIVNSFKSRNAIFREPLAVPTPETFSLIGY 61 AR+ F G VH L AY +IALFP+ L ++NS KSR+AIF PLA PTP++FSLIG+ Sbjct: 24 ARSRFANLGRIWVHVVLCAYAVIALFPIALILINSVKSRDAIFDNPLAFPTPDSFSLIGF 83 Query: 62 ETVLKQGDFIGYFQNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGIMIP 121 E VL +F+ YF NS++VT+ S+ L++LFGAMA +ALSEY+FRGN LM LYLALGIMIP Sbjct: 84 EKVLHNTNFMLYFGNSLVVTLGSLVLIVLFGAMAGWALSEYKFRGNRLMALYLALGIMIP 143 Query: 122 IRLGTVAILQGMVATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGL 181 IRLGTV+ILQ +V+ L+NT TALILVYTAQGLPLAV ILSEF+R + +LK+A R DG+ Sbjct: 144 IRLGTVSILQLVVSLDLINTRTALILVYTAQGLPLAVMILSEFIRQIPKELKDAARCDGV 203 Query: 182 SEYAIFLRLVLPLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQIFIGQFV 241 E+ IF +++LPLIRPA+ATVAVFTMIP WNDLWFPLILAP++ TKTVTLG Q FIGQ+V Sbjct: 204 GEFKIFFQIILPLIRPAIATVAVFTMIPAWNDLWFPLILAPSDETKTVTLGVQQFIGQYV 263 Query: 242 TNWNAVLSALSLAIFPVLVLYVIFSRQLIRGITAGAVK 279 T+WN+VL+ALSLA+ P+L++YVIFSRQLIRG+T+GAVK Sbjct: 264 TDWNSVLAALSLAVIPILIMYVIFSRQLIRGLTSGAVK 301 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 301 Length adjustment: 26 Effective length of query: 253 Effective length of database: 275 Effective search space: 69575 Effective search space used: 69575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory