Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_061942024.1 CPter91_RS16295 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_001584185.1:WP_061942024.1 Length = 661 Score = 253 bits (645), Expect = 1e-71 Identities = 133/319 (41%), Positives = 185/319 (57%), Gaps = 7/319 (2%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYL-----EEHKVEVKDGC 60 L+ DVGGTNAR AL + A G+I +T DY + YL + +V+ Sbjct: 23 LLADVGGTNARFAL-ERAPGQIDTIQTLRCADYAEFAQAVETYLAYSATQGAHAQVRHAA 81 Query: 61 IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG 120 IAIA P+ GD + MTNH WAFSI ++ L L ++NDFTA+SM++P L++ H +Q G Sbjct: 82 IAIANPVQGDDIKMTNHNWAFSIENTRRRLNLDTLLVVNDFTALSMSLPHLEQAHCVQIG 141 Query: 121 GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE 180 G + G + + GAGTGLGV L+ + RW++L EGGHV FAP EA +L Sbjct: 142 GGRALSGGVVGLVGAGTGLGVGGLIPTEGRWIALGSEGGHVTFAPGDAREAAVLAYCWRT 201 Query: 181 IGHVSAERVLSGPGLVNLYRAIVKADN-RLPENLKPKDITERALADSCTDCRRALSLFCV 239 HVSAER++SGPG+ +Y+A+ + PE L+ I ERAL C + FC Sbjct: 202 YSHVSAERLVSGPGIEMIYQALAELQGIAKPEPLQTAQIVERALQGQDGLCMEVVECFCA 261 Query: 240 IMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLI 299 ++G ++A+ LGT GG++I GG+VPR E+F S FRA FE+KGRF Y+ IP ++I Sbjct: 262 MLGTVAADVAVTLGTLGGLYIGGGVVPRLGEYFARSPFRARFENKGRFSSYLAKIPTFVI 321 Query: 300 VHDNPGLLGSGAHLRQTLG 318 P +G A L + LG Sbjct: 322 TAPYPAFVGVAAILSEHLG 340 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 661 Length adjustment: 33 Effective length of query: 288 Effective length of database: 628 Effective search space: 180864 Effective search space used: 180864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory