Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_061939852.1 CPter91_RS10210 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::G3LHY8 (358 letters) >NCBI__GCF_001584185.1:WP_061939852.1 Length = 363 Score = 181 bits (458), Expect = 4e-50 Identities = 100/289 (34%), Positives = 160/289 (55%), Gaps = 14/289 (4%) Query: 31 VLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGTDVTGMPVQKRNVAMVYQQFINYPALTV 90 VLLGP+ GK++++R+MAGL+ +GG++H V +P ++R++AMV+Q ++ YP +TV Sbjct: 33 VLLGPSGCGKSTILRMMAGLEEISGGALHIGARQVNDLPPRERDIAMVFQNYVLYPHMTV 92 Query: 91 YNNIASPMRISGKDAATIDREVRKAAELLKLTPYLDRTPLNLSGGQQQRTALARALVKNA 150 Y+N+A +R + I + V + A++L L P L R P +SGGQQQR A+ RA++K Sbjct: 93 YDNMAFGLRRLKTPESEISQRVGQVAQMLSLEPLLQRKPKQMSGGQQQRVAIGRAMIKTP 152 Query: 151 SLVLMDEPLANLDYKLREELREELPKIFAQSGAIFVYATTEPSEALLLGGNTATLNQGRV 210 ++ L DEPL+NLD KLR +LR ++ ++ Q VY T + EA+ L L GR+ Sbjct: 153 AVFLFDEPLSNLDAKLRAQLRGDIKRLHRQLATTSVYVTHDQLEAMTLADRIVLLKAGRI 212 Query: 211 TQFGPTIEVYRRPVNLATAGIFADPPLNTLDVTKSGNVFTRPSGVTI--------PVPSH 262 Q G E+Y PV+ AG P +N + G V + G+T+ +P Sbjct: 213 EQVGTPAEIYNHPVSRFAAGFIGTPAMNFI-----GCVASHEDGMTVLDSGEARWRLPPS 267 Query: 263 LAVVPDG-PVTIAFHPHHLGLAPQTGDAARLQARTLVSEITGSESFVHL 310 L V +G V + P+H+ ++ + + E+ G+ES V L Sbjct: 268 LFAVSEGQSVVLGVRPNHMFTTSVGDRQIEVRGKVDLVELLGAESLVSL 316 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 363 Length adjustment: 29 Effective length of query: 329 Effective length of database: 334 Effective search space: 109886 Effective search space used: 109886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory