Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate WP_061945227.1 CPter91_RS24210 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc03063 (380 letters) >NCBI__GCF_001584185.1:WP_061945227.1 Length = 283 Score = 135 bits (340), Expect = 1e-36 Identities = 71/228 (31%), Positives = 128/228 (56%), Gaps = 6/228 (2%) Query: 152 DNYAEVLSAAGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLL 211 +NY V S + R +NSL + VP + + ++ + +AL F ++ + VG Sbjct: 62 ENYRAVFSNTPLTRYIVNSLLITVPVVIGAVALSCLSGFALGIYRFRLNLLVFFLFVGGN 121 Query: 212 VVPLQMSLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIM 271 VP Q+ ++P+ L +G + + +G+ L HT F + +RN++ LP E++ Sbjct: 122 FVPFQILMVPVRDLSLRLGLYDSI-----LGLVLFHTAFQAGFCTFFMRNFIRDLPFELI 176 Query: 272 ESARVDGASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGR 331 ++AR++GAS+F++F KI+LPL PA+A+ ++ F + WND A V + GD + +T Sbjct: 177 DAARIEGASEFEVFWKIVLPLVRPAIAAVSVLIFTFVWNDYFWATVLI-QGDHAMPVTAG 235 Query: 332 LVNLLGSRGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKG 379 L +L G W +++A + I + P++VFF +Q++ + GL G+ KG Sbjct: 236 LKSLNGQWVAQWNLVSAGSIIAALPPVLVFFLMQKHFIAGLTMGATKG 283 Score = 32.7 bits (73), Expect = 1e-05 Identities = 12/41 (29%), Positives = 21/41 (51%) Query: 8 PLTWAVHLSVLLLVLLWTLPTAGLLISSLRDKDQLAVSGWW 48 PL W + VLL + +W LP + ++S+R + +W Sbjct: 12 PLQWLYRVCVLLALSIWLLPLVAVALTSVRGAADINAGNYW 52 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 380 Length of database: 283 Length adjustment: 28 Effective length of query: 352 Effective length of database: 255 Effective search space: 89760 Effective search space used: 89760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory