Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_061941789.1 CPter91_RS15500 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_001584185.1:WP_061941789.1 Length = 373 Score = 202 bits (513), Expect = 1e-56 Identities = 124/366 (33%), Positives = 207/366 (56%), Gaps = 27/366 (7%) Query: 1 MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTG 60 M + VK ++K + GK L ++N+ I++GE ++GPSG GK+T +R++ GL+ ++G Sbjct: 1 MANVSVKQLTKSYD-GKQNVLADLNLEIKDGEFVVLVGPSGCGKSTLLRMLCGLESITSG 59 Query: 61 ELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR 120 EL DR+V +PP +R I MVFQ++ALYP++T ++N+AF L K I +R Sbjct: 60 ELSIGDRVVNH-----LPPAERGIAMVFQSYALYPHMTVYKNMAFGLKIAGADKTAIDQR 114 Query: 121 VEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSAR 180 + A IL I H+L+ PRELSGGQ+QRVA+ RA+V+ P L L DEP SNLDA +R R Sbjct: 115 IRHAAGILKIDHLLDRLPRELSGGQRQRVAIGRAIVRKPKLFLFDEPLSNLDAALRVQTR 174 Query: 181 ALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASL 240 + ++ +L T++ V+HD + + D++ V+ G + Q G P +LY P ++ VA+ Sbjct: 175 LEIAKLHKQLEATIVYVTHDQVEAMTLGDKIVVMNDGFIQQAGSPLELYQRPKNLFVATF 234 Query: 241 IG--EINELEGKVTNEG-----VVIGS---LRFPVSV----SSDRAIIGIRPEDVKLSKD 286 IG ++N G V++ + +G+ +R V+ + D +G+RPE Sbjct: 235 IGSPKMNLFNGTVSSVAADCLHIKLGNGQEIRADVAAGATKAGDAVTVGLRPE------H 288 Query: 287 VIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFT-YSDHPIHSGEEVLVYVRKD 345 ++++ V GKV ++ + G I +T D ++ + ++P+H G+ V + Sbjct: 289 ILENAHSGEVFTGKVSIVEHLGEANFIYVTLQDGQDLLVRGDGNNPVHIGDSVTLSAPSS 348 Query: 346 KIKVFE 351 VF+ Sbjct: 349 AFHVFD 354 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 373 Length adjustment: 29 Effective length of query: 324 Effective length of database: 344 Effective search space: 111456 Effective search space used: 111456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory