Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_061942033.1 CPter91_RS16320 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_001584185.1:WP_061942033.1 Length = 380 Score = 369 bits (947), Expect = e-107 Identities = 194/380 (51%), Positives = 258/380 (67%), Gaps = 12/380 (3%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA + + ++ K YP E +K +L+I+D +F + VG SGCGK+T L MIAGLE ++EG Sbjct: 1 MASLSIRNVRKVYPNGNE-VLKGIDLEIEDGQFLILVGGSGCGKSTLLNMIAGLETVSEG 59 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 + IGDR VNDVPPK+RDIAMVFQ+YALYP MTV +N++FGL +RKVPKAE + V+ A Sbjct: 60 QIMIGDRCVNDVPPKERDIAMVFQSYALYPTMTVRENISFGLGIRKVPKAEQKQIVERVA 119 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 L I HLLDRKP LSGGQRQRVA+GRAI R+P +FL DEPLSNLDAKLRV+MRAEI+ Sbjct: 120 NTLQITHLLDRKPALLSGGQRQRVAMGRAIARDPSLFLFDEPLSNLDAKLRVEMRAEIKL 179 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 +HQRL +T++YVTHDQ EAMT+GDRI VM+DGV+QQ +PQ +Y P N+FVAGFIGSP+ Sbjct: 180 MHQRLGSTIVYVTHDQIEAMTLGDRIAVMKDGVVQQFGSPQEIYDNPSNLFVAGFIGSPS 239 Query: 241 MNFIRGEIVQDGDAFYFR----APSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDE 296 MNF+RG +V +G F + L L + + + +GK V+LG+RPE + D Sbjct: 240 MNFMRGNLVANGHGPAFELTHGGRTTLLPLAPAQAQRPEIAAWVGKEVILGIRPEHVTDA 299 Query: 297 EVFMTT-------YPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSV 349 + T+ Y + + VE+ E G + + T+ + R +PR + Sbjct: 300 QSARTSEAAGDSNYHPTEVGCTVELTEPTGPDTLVFTTFNEARVTCRTHPRAAAKPKDEM 359 Query: 350 KLAIDLNKIHIFDAETEESI 369 +LA DL+K +FDA+TEE I Sbjct: 360 QLAFDLSKAVLFDAKTEERI 379 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 380 Length adjustment: 30 Effective length of query: 354 Effective length of database: 350 Effective search space: 123900 Effective search space used: 123900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory