Align Fructose import permease protein FrcC (characterized)
to candidate WP_061938906.1 CPter91_RS07340 ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >NCBI__GCF_001584185.1:WP_061938906.1 Length = 343 Score = 210 bits (535), Expect = 4e-59 Identities = 113/301 (37%), Positives = 176/301 (58%), Gaps = 8/301 (2%) Query: 56 VLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMVLSSV 115 +L+L+ F F + ILQ A+ G++ A T VI+TAGIDLSVG +M +V Sbjct: 40 LLALMVFFSFASSNFLEIDNLVSILQSTAVNGVLAIACTFVIITAGIDLSVGTLMTFCAV 99 Query: 116 IMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLASNFLY 175 + G F G P + ++ + GALCG+++G LVA++K+PPFI TLGM ++ + + Sbjct: 100 MAGVFLTYMGLPIYIGIVAAVFFGALCGWVSGVLVAKLKIPPFIATLGMMMLLKGLSLVI 159 Query: 176 SANETIRAQDISANASILQFFGQNFRIGNAV----FTYGVVVMVLLVCLLWYVLNRTAWG 231 S + I D ++I Q+ IG+ + V+++ L+ +LN+T +G Sbjct: 160 SGTKPIYFNDTPGFSAI----SQDSLIGSLIPVLPIPNAVLILFLVAIGAGIILNKTIFG 215 Query: 232 RYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTAGQFANIE 291 RY +A+G + EA +L+GVNV ++IYT SG IC +AG + R+ S P GQ ++ Sbjct: 216 RYTFALGSNEEALRLSGVNVDFWKVAIYTFSGAICGIAGLLIASRLNSAQPALGQGYELD 275 Query: 292 SITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVAI 351 +I AVVIGG SL GG G+I+G + GA I+ V GLR+M +W ++ G++II+AV + Sbjct: 276 AIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLINGLRMMSVAQEWQTVVTGVIIILAVYM 335 Query: 352 D 352 D Sbjct: 336 D 336 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 343 Length adjustment: 29 Effective length of query: 331 Effective length of database: 314 Effective search space: 103934 Effective search space used: 103934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory