Align ABC transporter (characterized, see rationale)
to candidate WP_061936158.1 CPter91_RS01695 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_001584185.1:WP_061936158.1 Length = 379 Score = 340 bits (872), Expect = 4e-98 Identities = 196/374 (52%), Positives = 258/374 (68%), Gaps = 18/374 (4%) Query: 1 MIKLKLDNVNKQLGGMR-ILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGD 59 M + L ++ K G I+R+V LEI EF VF+GPSGCGKSTLLR+IAGL+ G+ Sbjct: 1 MASISLRSLQKSYGSAAPIIRNVDLEIGEHEFCVFLGPSGCGKSTLLRIIAGLEDPSDGE 60 Query: 60 LLIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQ 119 LLIDG+ +ND+ +R V MVFQSYAL+PHM+V++N+SFGL LAK K + ++V + A+ Sbjct: 61 LLIDGKPMNDVPSAQRSVAMVFQSYALFPHMTVFENMSFGLTLAKLPKAEIEQKVREAAR 120 Query: 120 ILQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARL 179 ILQL++LL+RKPKELSGGQRQRVA+GRA+ R P + LFDEPLSNLDA+LR Q R EIARL Sbjct: 121 ILQLEELLKRKPKELSGGQRQRVAIGRAIVRRPGVFLFDEPLSNLDATLRSQTRIEIARL 180 Query: 180 HDRL-GSTMIYVTHDQVEAMTLADKIVVLNG-------GRVEQVGSPRELYERPASRFVA 231 H + +++IYVTHDQVEAMTLAD+IV+L+ G V QVG+P ELY P +RFVA Sbjct: 181 HRQFERASVIYVTHDQVEAMTLADRIVLLHAGADTAAFGSVAQVGTPMELYHHPKNRFVA 240 Query: 232 GFLGSPRMNFLSARLQ--TPGETSL-VDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVS 288 GF+GSPRMNFL A + PGE ++ + + FD S L G ++LGIRPEH Sbjct: 241 GFIGSPRMNFLPAVVTRIDPGEVTVRLSDTDETVQVHAFDPS-LQQGQAVTLGIRPEH-- 297 Query: 289 LKAADGT-AGVV--VTAVEYLGSETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLD 345 L ++D T AG+ V VE LG +TYVHLE +PL+ + + Q G+R+ + Sbjct: 298 LDSSDTTSAGLTREVVLVERLGEQTYVHLEQPGGQPLVAKAPGNTSIQRGERLRFGISAA 357 Query: 346 NLHLFDADGVALSR 359 +LFDA GVA+++ Sbjct: 358 CTYLFDASGVAIAK 371 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 379 Length adjustment: 30 Effective length of query: 351 Effective length of database: 349 Effective search space: 122499 Effective search space used: 122499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory