Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate WP_061945734.1 CPter91_RS01735 zinc-binding alcohol dehydrogenase family protein
Query= curated2:Q72L62 (343 letters) >NCBI__GCF_001584185.1:WP_061945734.1 Length = 336 Score = 141 bits (355), Expect = 3e-38 Identities = 104/333 (31%), Positives = 158/333 (47%), Gaps = 14/333 (4%) Query: 13 LTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRIRPPLVTGHEFSG-VVEA 71 L + RP+P PG++L+RV+ ICGTD+HI++ + + P V GHE +G VVEA Sbjct: 12 LRMEQRPMPVRNPGDVLIRVKRVGICGTDMHIYRG---TQPYLDYPRVMGHELAGEVVEA 68 Query: 72 VGPGVKRPQVGDHVSLESHVVCHACPACRTGNYHVCLNTKILGVDRDGGFAEYVVVPAEN 131 P GD V + ++ C AC ACR G + C N ++LGV RDGG AEY +P++ Sbjct: 69 --PAASGLSTGDTVYVMPYMACGACVACRKGKTNCCTNIQVLGVHRDGGLAEYTSIPSQF 126 Query: 132 AWVNPKDLPFEVAAILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVARASGAGP 191 + + + + AA++E H V + G++ L+ GAGPIG+ A+ AR GA Sbjct: 127 VF-KAEGISLDDAAMIEFLAIGAHAVRRAAIQPGQNALVVGAGPIGIAVALFARLRGA-K 184 Query: 192 ILVSDPNPYRLAFARPYAD--RLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGL 249 + + D RL F R + E D L++ +V+ + +GN A+ +G Sbjct: 185 VCMLDTRADRLQFCREILQIPSTIEVGENDKLQLAEFTQQDFFDVVFDATGNAKAMERGF 244 Query: 250 MALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRRLWQTWMQGTALVYSGRVDL 309 + GG + I I F E R I G + + + + A + +G V Sbjct: 245 EFVAHGGTYVFVSIVGGNISFS-DPEFHKREIALLG-SRNATTEDFEEVLAAMRAGLVPT 302 Query: 310 SPLITHRLPLSRYREAFGLL--ASGQAVKVILD 340 L THR L F L S +K I+D Sbjct: 303 RSLNTHRTTLDELPAIFSLWMEPSAGVIKAIVD 335 Lambda K H 0.321 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 336 Length adjustment: 28 Effective length of query: 315 Effective length of database: 308 Effective search space: 97020 Effective search space used: 97020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory