Align ABC transporter permease (characterized, see rationale)
to candidate WP_167595232.1 CPter91_RS16310 ABC transporter permease subunit
Query= uniprot:A0A165KPZ4 (293 letters) >NCBI__GCF_001584185.1:WP_167595232.1 Length = 292 Score = 400 bits (1028), Expect = e-116 Identities = 194/287 (67%), Positives = 233/287 (81%) Query: 7 ETWLPKLVVAPAFVLGFAFIYGLMVWNGVLSLTVSRMLPNYEWAGLAQYERLWEMDRWWV 66 + WLP+LV++P +L F+YG + LSLT SRMLPNYE +G QY L+ +DRWWV Sbjct: 6 DAWLPRLVLSPTIILSLVFVYGFIGVTAWLSLTNSRMLPNYEISGFNQYVELFGLDRWWV 65 Query: 67 ALKNLGIFGVGYVGGSLLIGVVLAVLLDQKIRAEGALRTIYLYPMALSFVVTGTAWKWLL 126 A NLGIFG ++ L IG+ +A+LLDQKIRAEGALR IYLYPMALSF+VTG AWKW+L Sbjct: 66 AAANLGIFGGLFILFCLAIGLFMAILLDQKIRAEGALRAIYLYPMALSFIVTGAAWKWIL 125 Query: 127 NPGLGIEKMVRDWGFPNFEFGWLVDTEMAIYCVVIAGIWQSAGFAMALFLAGLRGIDDSI 186 NPGLG+EKM+ DWGF NF F WLV+++ +IY VVIAG+WQS+GF MALFLAGLRGIDDSI Sbjct: 126 NPGLGLEKMMHDWGFANFHFDWLVNSDFSIYTVVIAGVWQSSGFVMALFLAGLRGIDDSI 185 Query: 187 IKAAQVDGASLPRIYWRIVLPALRPVFFSTLMVLSHLAIKSFDLVMALTAGGPGFATDVP 246 IKAA VDGASLP IY RIV+PALRPVFFS L+VL+H+AIKSFDLVMALTAGGPG ++D+P Sbjct: 186 IKAAMVDGASLPTIYRRIVIPALRPVFFSVLLVLAHIAIKSFDLVMALTAGGPGTSSDLP 245 Query: 247 ATFMYTMSFSRGQIGLGAASATMMLATVAALVIPYLYSELRTKAHDR 293 A FMY SFSRGQ+GLGAASA MMLATV A+++P +Y E + + R Sbjct: 246 AIFMYQFSFSRGQLGLGAASAMMMLATVLAVLVPMMYLETKGARNGR 292 Lambda K H 0.327 0.141 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 292 Length adjustment: 26 Effective length of query: 267 Effective length of database: 266 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory