Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate WP_061939852.1 CPter91_RS10210 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q00752 (377 letters) >NCBI__GCF_001584185.1:WP_061939852.1 Length = 363 Score = 306 bits (783), Expect = 8e-88 Identities = 165/359 (45%), Positives = 231/359 (64%), Gaps = 21/359 (5%) Query: 21 VEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKGELKIDGEVVNDKAPKDRDIA 80 V DF ++I + EFIV +GPSGCGKST LRM+AGLE+I+ G L I VND P++RDIA Sbjct: 19 VHDFSMEIADAEFIVLLGPSGCGKSTILRMMAGLEEISGGALHIGARQVNDLPPRERDIA 78 Query: 81 MVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAAQILGLTEFLERKPADLSGGQ 140 MVFQNY LYPHM+VYDNMAFGL+ + I +RV + AQ+L L L+RKP +SGGQ Sbjct: 79 MVFQNYVLYPHMTVYDNMAFGLRRLKTPESEISQRVGQVAQMLSLEPLLQRKPKQMSGGQ 138 Query: 141 RQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTIYVTHDQTEAM 200 +QRVA+GRA+++ VFL DEPLSNLDAKLR +R +I ++HR++ T++YVTHDQ EAM Sbjct: 139 QQRVAIGRAMIKTPAVFLFDEPLSNLDAKLRAQLRGDIKRLHRQLATTSVYVTHDQLEAM 198 Query: 201 TLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANKFVAGFIGSPAMNFFDVTIKD 260 TLADRIV++ + GR+EQVGTP E+YN P ++F AGFIG+PAMNF Sbjct: 199 TLADRIVLLKA----------GRIEQVGTPAEIYNHPVSRFAAGFIGTPAMNFIGCVAS- 247 Query: 261 GHLVSKDGLTIAVTEGQLKMLESKGF---KNKNLIFGIRPEDISSSLLVQETYPDATVDA 317 +DG+T+ + L F + ++++ G+RP + ++ + V Sbjct: 248 ----HEDGMTVLDSGEARWRLPPSLFAVSEGQSVVLGVRPNHMFTTSVGDR---QIEVRG 300 Query: 318 EVVVSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVSLTFNVAKGHFFDAETEAAI 376 +V + ELLG+E+++ L + E A V A G++V ++ H FDAET +++ Sbjct: 301 KVDLVELLGAESLVSLLHAKHEITALVPANRCPRVGDQVCFNISLNDLHVFDAETGSSL 359 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 363 Length adjustment: 30 Effective length of query: 347 Effective length of database: 333 Effective search space: 115551 Effective search space used: 115551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory