Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_061936170.1 CPter91_RS01725 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_001584185.1:WP_061936170.1 Length = 327 Score = 250 bits (639), Expect = 3e-71 Identities = 133/309 (43%), Positives = 193/309 (62%), Gaps = 16/309 (5%) Query: 32 ILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFAGLC 91 ++L +V + +S+ F T N M + Q + IL +G T VI+T GIDLSVGS+LA AG+ Sbjct: 19 VVLGLVFSLTSDAFFTLNNGMSVALQVTSIAILGIGATCVIITGGIDLSVGSVLALAGVI 78 Query: 92 SAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTFILND 151 +AMV G + + G+ GA+ G +NG + L +PPF+ATLGM+ +ARG+ + Sbjct: 79 AAMVVKAGMPVPVGMLCGLAVGAVCGGLNGLCITQLKLPPFIATLGMMLVARGVALQVTG 138 Query: 152 GSPITDLPDAYLALGIGKI--------GP--------IGVPIIIFAVVALIFWMVLRYTT 195 P++ LP+ + LG G + GP I P+I+ V+A++ ++L T Sbjct: 139 ARPVSGLPEEFGTLGNGTLFRIVKETTGPFPDVVFPGIPYPVILMVVIAIVISIMLSRTQ 198 Query: 196 YGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYE 255 +GR++YAVG N ++AR SG+ V +V YV+SG LAGL G VL +R +A P GV YE Sbjct: 199 FGRHIYAVGSNAEAARLSGVKVARVTLWTYVISGTLAGLTGCVLMSRLVTAQPNEGVMYE 258 Query: 256 LDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAV 315 LDAIA+ VIGGTSL GG G+I GT G+ +IG++ NGLN+ GVSS+ QQ+ GL+I+ V Sbjct: 259 LDAIASAVIGGTSLIGGIGTISGTAIGSFVIGILRNGLNMNGVSSFVQQIIIGLVILLTV 318 Query: 316 LIDVWRKKK 324 ID R ++ Sbjct: 319 WIDQMRNRR 327 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 327 Length adjustment: 28 Effective length of query: 297 Effective length of database: 299 Effective search space: 88803 Effective search space used: 88803 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory