Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_061945961.1 CPter91_RS07485 ribose ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_001584185.1:WP_061945961.1 Length = 328 Score = 253 bits (646), Expect = 5e-72 Identities = 150/327 (45%), Positives = 207/327 (63%), Gaps = 9/327 (2%) Query: 1 MNAKTITAPVTAAPRNRLRLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSI 60 M A + T R +LR L G+ V +LL + A SE F T +N I +Q S+ Sbjct: 1 MEASSRITAETIGKREQLRGLLRTVGMLPVLLLLVLGFALMSENFFTVQNLSIITQQASV 60 Query: 61 NGILAVGMTYVILTKGIDLSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVVN 120 N +LA GMT+VILT GIDLSVG+ILA A + + + + + ++AG+ G +LG+ N Sbjct: 61 NIVLAAGMTFVILTAGIDLSVGAILAAAAVVAMLASLSPQFGMLGIAAGIGFGLLLGLAN 120 Query: 121 GFMVANLSIPPFVATLGMLSIARGMTFILNDGSPI--TDLPDAYLALGIGKIGPIGVP-- 176 G ++A + +PPF+ TLG L+ RG+ +L D + DLP A+ IG +GVP Sbjct: 121 GALIAFMRLPPFIVTLGALTAMRGLARLLADDKTVFNPDLPFAF----IGNDSLLGVPWL 176 Query: 177 IIIFAVVALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAG 236 +II VV + W +LR T G +YAVGGN ++AR SGI V KV+ VY VSGLLAGL Sbjct: 177 VIIALVVVALSWFILRRTVIGVQIYAVGGNHEAARLSGIKVWKVLLFVYAVSGLLAGLGA 236 Query: 237 VVLSARTTSALP-QAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNL 295 V+ ++R ++A Q G SYELDAIAAV++GGTS +GG GSI GTL GAL+I V+ NGL L Sbjct: 237 VMTASRLSAANGLQLGQSYELDAIAAVILGGTSFTGGVGSIGGTLIGALIIAVLTNGLVL 296 Query: 296 LGVSSYYQQVAKGLIIVFAVLIDVWRK 322 LGVS +Q + KG++I+ AV +D +R+ Sbjct: 297 LGVSDIWQYIIKGIVIIGAVALDRYRQ 323 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 328 Length adjustment: 28 Effective length of query: 297 Effective length of database: 300 Effective search space: 89100 Effective search space used: 89100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory