Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate WP_061939148.1 CPter91_RS08085 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >NCBI__GCF_001584185.1:WP_061939148.1 Length = 314 Score = 134 bits (337), Expect = 3e-36 Identities = 96/293 (32%), Positives = 142/293 (48%), Gaps = 9/293 (3%) Query: 7 FTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIAR 66 F GI P+ T F G+LD L L AGV GL G+ GE + L E+ + Sbjct: 4 FEGIWVPLVTPFR-QGKLDLYSAQQLALSLSGAGVHGLVVCGTTGEAATLNEHEQDKLLC 62 Query: 67 FAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQ 126 ++ V R PVL+G G++ R E H G +V P Y + S+ + +FE Sbjct: 63 GVLEAVQNRCPVLMGVSGSDTRVVAEKISHLNTLQPAGFLVSAPSYVRPSQEGIRLHFEA 122 Query: 127 VADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGA 186 VA + PV+LYN P+ TG ++ PA V L + ++NI+ IK+ S+A +IH Sbjct: 123 VAAAAHCPVVLYNIPSRTGVNIEPATVIAL-ERQANIVAIKECGGSLAQTTELIH----- 176 Query: 187 HPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLL 246 H +LCG D LFNTL LG GAISA+ + P + V L + R G + +A + LL Sbjct: 177 HSSLKILCGDDAALFNTLCLGAHGAISAAAHIRPDLFVRLFELVRAGQIERARILFKQLL 236 Query: 247 QIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQL 299 + Q+ P +K A+ L G + + P +P+ + +L L L Sbjct: 237 PVIQLL-FSEPNPAPVKAALALQGH-IQDELRLPMTPMSAVGRVKLARALDAL 287 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 314 Length adjustment: 27 Effective length of query: 275 Effective length of database: 287 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory