Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_061938896.1 CPter91_RS07315 SDR family oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_001584185.1:WP_061938896.1 Length = 254 Score = 130 bits (327), Expect = 3e-35 Identities = 85/254 (33%), Positives = 134/254 (52%), Gaps = 15/254 (5%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVD 75 L+GKR+L+T G GIG FAR+G V DI A + A G ++D Sbjct: 3 LQGKRILLTAAGQGIGRATALMFAREGGQVLATDINPAALEETAALARAAGSSLVTRQLD 62 Query: 76 LTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCAQ 135 +TDVA+ +A L + FD+L N A +I + +E W+ ++N+ ++ Q Sbjct: 63 VTDVAA----VAALAQAEAPFDVLFNCAGYVHHGSILDCSEKDWEFSWNLNVSSMYRLIQ 118 Query: 136 AVVPAMRARGGGAIVNLGSISWHL-GLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATC 194 A++P M A+GGG+I+N+ S + + G+ + +Y T KAA+ GLT+++A D GIR Sbjct: 119 ALLPGMLAQGGGSIINMASAASSVKGVPNRFVYGTTKAAVIGLTKAVAADFVARGIRCNA 178 Query: 195 VIPGNVRTP---------RQLKWYS-PEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDA 244 + PG V +P QL+ E +A VA Q + E++AA+ L+LASD++ Sbjct: 179 ICPGTVESPSLEARITEQAQLQGKPIAEIQAAFVARQPMGRVGKAEEIAALALYLASDES 238 Query: 245 RLVTGHSYFVDAGW 258 TG + +D GW Sbjct: 239 SFTTGAIHLIDGGW 252 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 254 Length adjustment: 24 Effective length of query: 235 Effective length of database: 230 Effective search space: 54050 Effective search space used: 54050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory