Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate WP_061940318.1 CPter91_RS11535 ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >NCBI__GCF_001584185.1:WP_061940318.1 Length = 334 Score = 200 bits (509), Expect = 3e-56 Identities = 115/305 (37%), Positives = 178/305 (58%), Gaps = 14/305 (4%) Query: 13 LGPLVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPG 72 LGP++ L+ L + +LN F T NL + + A G++A+G TFVIISGG IDLS G Sbjct: 24 LGPVLGLIGLCIAGTLLNGDFATVDNLMNVLTRTAFIGIIAVGMTFVIISGG--IDLSVG 81 Query: 73 SMVAL-TGVMVAW---LMTHGVPVWISVILI-----LLFSIGAGAWHGLFVTKLRVPAFI 123 SM AL G M+ + LM+ G ++++LI LL + G HGL +TK ++ AFI Sbjct: 82 SMAALIAGSMIYFMNMLMSAGTLGPLTILLIGIAMALLLGLAFGCLHGLLITKGKIEAFI 141 Query: 124 ITLGTLTIARGMAAVITKGWPII---GLPSSFLKIGQGEFLKIPIPVWILLAVALVADFF 180 +TLGTL I R + + G + L + + L IPIP+W+ LAVAL Sbjct: 142 VTLGTLGIFRSVLTYLADGGALTLDNQLSDLYSPVYYTSLLGIPIPIWVFLAVALGGALI 201 Query: 181 LRKTVYGKHLRASGGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGV 240 L +T +G+H++A G NE AR++ + VD V+ +M+ G G+ ++ RL P Sbjct: 202 LNRTAFGRHVQAIGSNEQVARYAAIRVDFVKTCTYMLLGVCVGIATVLYVPRLGSASPTT 261 Query: 241 GSMYELYAIASTVIGGTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIV 300 G ++EL AIA+ V+GGT+L GG G ++G +VGA ++S++ N L L ++ + + N + V Sbjct: 262 GLLWELEAIAAVVVGGTALKGGSGRIVGTVVGAILLSVISNILNLTSIISVYLNAAVQGV 321 Query: 301 IVVAV 305 +++AV Sbjct: 322 VIIAV 326 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 334 Length adjustment: 28 Effective length of query: 289 Effective length of database: 306 Effective search space: 88434 Effective search space used: 88434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory