Align D-xylose ABC transporter, permease protein (characterized)
to candidate WP_061938416.1 CPter91_RS06295 sugar ABC transporter permease
Query= CharProtDB::CH_024441 (393 letters) >NCBI__GCF_001584185.1:WP_061938416.1 Length = 379 Score = 389 bits (999), Expect = e-113 Identities = 200/364 (54%), Positives = 262/364 (71%), Gaps = 2/364 (0%) Query: 28 QVFVMIAAIIAIMLFFTWTTDGAYLSARNVSNLLRQTAITGILAVGMVFVIISAEIDLSV 87 ++ ++ AI I FF+W T+G +++ RN+SNLLRQ +ITG+LA GMV VII+ EIDLSV Sbjct: 14 KIMALLIAIALIWAFFSWKTEGGFVTPRNLSNLLRQMSITGVLACGMVLVIIAGEIDLSV 73 Query: 88 GSMMGLLGGVAAICDVWLGWPLPLTIIVTLVLGLLLGAWNGWWVAYRKVPSFIVTLAGML 147 GSM+GLLGGVAA+ DV PL L +++ L+ GL LG +NG+ AY ++PSFIV L GML Sbjct: 74 GSMLGLLGGVAAVLDVTHHLPLSLNLLLVLLAGLALGLFNGYLTAYMRIPSFIVGLGGML 133 Query: 148 AFRGILIGITNGTTVSPTSAAMSQIGQSYLPASTGFIIGALGLMAF-VGWQWRGRMRRQA 206 AFRGIL+G+T G T++P S+ M +GQ YLP G +G +GL A + WR R RQ Sbjct: 134 AFRGILLGVTGGLTIAPVSSEMVYLGQGYLPPQLGIALG-IGLFALALVLSWRRRSNRQQ 192 Query: 207 LGLQSPASTAVVGRQALTAIIVLGAIWLLNDYRGVPTPVLLLTLLLLGGMFMATRTAFGR 266 GL P+ R L ++L + LN Y G+P PVLLL LL ++ T+T FGR Sbjct: 193 HGLPVPSVWRDAVRVLLIGAVLLAFVRTLNTYDGIPVPVLLLLALLGLFSYLTTQTVFGR 252 Query: 267 RIYAIGGNLEAARLSGINVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDA 326 RIY++G N+EA RLSG+NV+ KL VF I G+M A+AGL+ ++RL AGSPSAGN+ ELDA Sbjct: 253 RIYSVGSNMEATRLSGVNVQAVKLWVFGIMGVMCALAGLVNTARLAAGSPSAGNMGELDA 312 Query: 327 IAACVIGGTSLAGGVGSVAGAVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMD 386 IAAC IGGTS+ GG G+V GA++GA +MASLDNGMSM+DV T+WQ IVKG IL+LAVW+D Sbjct: 313 IAACFIGGTSMRGGYGTVYGALIGALVMASLDNGMSMLDVDTYWQMIVKGGILMLAVWVD 372 Query: 387 SATK 390 +T+ Sbjct: 373 VSTR 376 Lambda K H 0.325 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 379 Length adjustment: 30 Effective length of query: 363 Effective length of database: 349 Effective search space: 126687 Effective search space used: 126687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory