GapMind for catabolism of small carbon sources

 

Protein WP_068219354.1 in Roseivirga spongicola UST030701-084

Annotation: NCBI__GCF_001592965.1:WP_068219354.1

Length: 250 amino acids

Source: GCF_001592965.1 in NCBI

Candidate for 42 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 41% 90% 150.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-lysine catabolism hisP med ABC transporter for L-Lysine, ATPase component (characterized) 41% 84% 143.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 36% 73% 153.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 40% 90% 151 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 35% 93% 147.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 38% 55% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 38% 91% 142.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 37% 89% 142.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 38% 91% 142.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 37% 89% 142.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 38% 58% 141.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 35% 63% 139 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 33% 93% 137.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 83% 137.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 37% 83% 137.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 37% 84% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 90% 136.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 39% 82% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 90% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 90% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 90% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 90% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 90% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 38% 82% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 32% 63% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 32% 63% 132.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 38% 74% 128.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 60% 127.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 60% 127.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 35% 53% 126.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 35% 57% 126.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 37% 81% 125.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 76% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 34% 80% 121.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 93% 112.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 30% 73% 104.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-alanine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-histidine catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-leucine catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-proline catabolism natA lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-serine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5
L-threonine catabolism braF lo NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 30% 79% 96.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 58% 266.5

Sequence Analysis Tools

View WP_068219354.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSKTIIKTTNISKVYQMGSEKIQALKSVSIEIKQGEYVAFMGPSGSGKSTLMNTIGCLDT
PSGGTYILNGQDVSDMTENELAETRNKEIGFVFQTFNLLPRASSLENVALPLIYAGYSKS
EREDRAQAALTSVGLGERSFHKPNELSGGQRQRVAIARALVNDPSIILADEPTGNLDTRT
SYDIMDLFAALHEKGNTIIMVTHEDDIAQYSHRVIRLRDGLIEKDIINENPTNTAVMRAA
YEAEVAKRVF

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory