Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_068221987.1 AWW68_RS13720 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_001592965.1:WP_068221987.1 Length = 288 Score = 151 bits (382), Expect = 2e-41 Identities = 95/267 (35%), Positives = 151/267 (56%), Gaps = 11/267 (4%) Query: 23 NVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDR 82 +++ + GE I G SGAGKT+ +R+IAGL P +G + + + K + P+ R Sbjct: 20 DLDFKCQAGEFLVISGESGAGKTSLLRMIAGLMNPDSGNIISNQEPWFGH-KTNIKPQQR 78 Query: 83 KIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELS 142 G+VFQ +AL+PN+T N+ + L K + +EE+ I++I + N P +LS Sbjct: 79 NCGLVFQQYALFPNMTVEGNLRYAL-----KKSQADSIIEELLDIMEIKGLRNQKPNQLS 133 Query: 143 GGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPA 202 GGQQQRVALAR LV+ P LLLLDEP S LD MR + +K+V + +T ++V+HDP+ Sbjct: 134 GGQQQRVALARTLVQKPKLLLLDEPLSALDRSMRIRLQEYLKKVHQQFELTTIMVTHDPS 193 Query: 203 DIFAIADRVGVLVKGKLVQVGKPEDLYDNPV---SIQVASLIGEINELEGKVTNEGVVIG 259 + +ADR+ + KG + + GKP +++ N Q + +I E E + V++G Sbjct: 194 EALRLADRIIEIEKGNITKDGKPTEVFGNKSLSGKFQFTGAVVDIQE-EELLCIASVLVG 252 Query: 260 SLRFPVSVS-SDRAIIGIRPEDVKLSK 285 + V +S S++ + I E + SK Sbjct: 253 NQLIKVVISDSEQKNLRIGDEVIVASK 279 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 288 Length adjustment: 27 Effective length of query: 326 Effective length of database: 261 Effective search space: 85086 Effective search space used: 85086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory