Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_068215625.1 AWW68_RS00945 ROK family protein
Query= BRENDA::O05510 (299 letters) >NCBI__GCF_001592965.1:WP_068215625.1 Length = 332 Score = 76.6 bits (187), Expect = 7e-19 Identities = 76/290 (26%), Positives = 119/290 (41%), Gaps = 52/290 (17%) Query: 4 GIEAGGTKFVCAVGREDGTIIDRIEFPTKMPDETIEKVIQYFSQF----------SLQAI 53 GI+ GGT + +G ++ PT E I+ + SQ ++ + Sbjct: 7 GIDIGGTFTKFGLTDVEGNVLMEGSIPTYTHKE-IKSFLDALSQAINESLDELNEPIEIL 65 Query: 54 GIGSFGPVDNDKTSQTYGTITATPKAGWRHY-PFLQTVKNEMKIPVGFSTDVNAAALGEF 112 G+G P N GTI P W+ PF+ K +P+ + D NAAA+GE Sbjct: 66 GVGIGAPNGN----YYKGTIEHAPNLHWKGIVPFIDMFKEYFDLPMVLTNDANAAAIGEK 121 Query: 113 LFGEAKGLDSCLYITIGTGIGAGAIVEGRLLQGLS--HPEMGHIYIRRHPDDVYQGKCPY 170 +FG AK +D + IT+GTG+G+G + G+L+ G E+GH + +PD + C Sbjct: 122 VFGGAKDMDDFIVITLGTGLGSGLVTRGKLIYGHDGLAGELGHTNV--YPDG-RECNCGK 178 Query: 171 HGDCFEGLASGPAI----------------------EARWGKKAADLSDIAQVWELEGY- 207 G C E AS I E+ KK +++ LE Y Sbjct: 179 RG-CLETYASASGIKRTVFKLLATNNVDTPLRTYTYESLTSKKITEMALEGDPIALEAYT 237 Query: 208 ----YIAQALAQYILILAPKKIILGGGVMQQKQVFSYIYQYVPKIMNSYL 253 + LA + +P+ I L GG+ + + + + K N YL Sbjct: 238 YTSDILGLKLADAAAVTSPQAIFLFGGLAKAGDI---LVEATKKSFNEYL 284 Lambda K H 0.320 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 332 Length adjustment: 27 Effective length of query: 272 Effective length of database: 305 Effective search space: 82960 Effective search space used: 82960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory