Align 3-oxoadipate CoA-transferase (EC 2.8.3.6) (characterized)
to candidate WP_068747418.1 ATZ99_RS01235 hypothetical protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4591 (259 letters) >NCBI__GCF_001601575.1:WP_068747418.1 Length = 253 Score = 170 bits (430), Expect = 3e-47 Identities = 97/242 (40%), Positives = 143/242 (59%), Gaps = 2/242 (0%) Query: 1 MTYTTNEMMTVAAARRLKNGSVCFVGIGLPSKAANLARLTSSPDVVLIYESGPIGAKPSV 60 + +TTNE+M V AAR +K+ VG+GLP AA LA+ T +P++ +IYE G I + Sbjct: 3 INFTTNELMAVTAARLIKDNENVVVGLGLPQIAALLAKNTHAPNLNIIYEIGVINPEAEE 62 Query: 61 LPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQVDRFGNINTTVVGDYHAP 120 + + I D L ++ LQ G +DVGFLG Q DRFGNIN+T+V Sbjct: 63 MGVGIADPRLWYKSEYFTSFVGTLGNVLQKGLVDVGFLGGLQTDRFGNINSTLVRSEKGI 122 Query: 121 KVRLPGAGGAPEIAGSAKSVLIILKQSSRSFVDKLDFITSVGHGEGGDSRKRLGLPGAGP 180 + + G+GGA +IA A+ +LII+K R V+ +D+ITSVG+ GG+SRK GLP Sbjct: 123 R-HINGSGGAADIASLARRLLIIMKHDKRKLVENVDYITSVGYLRGGNSRKESGLPMCEN 181 Query: 181 VGIITDLCIMEPEAGTHEFVVTALHPGVTREQVVDATGWAIRFADQVEQTAEPTEVELTA 240 + IIT+LC+ + + ++HPGV+ E++++ TG I + V+ T EPTE E+ Sbjct: 182 ITIITNLCVFGFDE-NKSIKLLSIHPGVSVEEIIENTGIKIEIPEGVKTTEEPTEAEINL 240 Query: 241 LR 242 LR Sbjct: 241 LR 242 Lambda K H 0.316 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 253 Length adjustment: 24 Effective length of query: 235 Effective length of database: 229 Effective search space: 53815 Effective search space used: 53815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory