Align glycerol-3-phosphate oxidase; EC 1.1.3.21 (characterized)
to candidate WP_068748634.1 ATZ99_RS07550 NAD(P)/FAD-dependent oxidoreductase
Query= CharProtDB::CH_000554 (387 letters) >NCBI__GCF_001601575.1:WP_068748634.1 Length = 488 Score = 278 bits (710), Expect = 3e-79 Identities = 148/370 (40%), Positives = 232/370 (62%), Gaps = 5/370 (1%) Query: 7 DICIIGGGIIGASVARELAKFDKKIVVLEANPRLALETSSHNSGLVHGGFDPRPETLNAK 66 D+ IIGGG++G ++A EL K++ +V+LE +A T+ NS ++H G+D +P TL AK Sbjct: 3 DVVIIGGGVVGTAIAYELGKYNLDVVLLEKGDDVASGTTKANSAIIHAGYDAKPGTLKAK 62 Query: 67 LNVLGKKRYEDWIKEMDFPYLRIDSTIVAFNDEEMKHVHMLYDRGLINGLDPKEMQVIDA 126 LNV G + +E+D P+ RI S ++AFNDEE+K + L +RG ING+ ++++I Sbjct: 63 LNVRGNFLFSKICEELDVPFKRIGSLVLAFNDEEIKEIENLLERGKINGI--PQIEIIGK 120 Query: 127 KELQKREPNISKQAVGALVCNSSIAIDPVLLTTTLMRNAIKNGVELKVNSKVVDIKKVDN 186 +++ K EPN++K+ AL ++ I P L NA NGVE K NS V+ I+K+ + Sbjct: 121 EDILKMEPNVNKEVKAALFAKTAGIICPYELAQAFGENAFLNGVEFKFNSPVIGIEKLKD 180 Query: 187 IFEIKTAKDEIIQAEVVVNVAGHYADVIANMAGYGDFKLTTRRGEYRILDKSEAGIVNSV 246 F +KT ++ I A ++N AG YAD IA MA ++K+ R+GEY + DKS IVN V Sbjct: 181 GFIVKTTHED-IHARFIINAAGVYADEIARMANAEEYKIIPRKGEYLLFDKSVGNIVNKV 239 Query: 247 VFMVPTIHGKGVIVAPMLDGRVMVGPTALDGVPKEETLLVTQQQYDNIGKIGKHLIPNIN 306 +F PT KG++V+P +DG +GP + + KE+T VT + + I K + L+PNI Sbjct: 240 LFPTPTKISKGILVSPTVDGNFFIGPNSNNQESKEDT-SVTLEGIEEIIKGAQRLVPNIP 298 Query: 307 MDKTCTVYAGSRPIDIETNDFIIRPAKNDKKFINVAGMKSPAIASAPAIADMVCDLVKNA 366 + T +AG R + ET+DF+I ++ K FIN G++SP +++APAIA+MV +++K+ Sbjct: 299 LKSVITSFAGIRAV-AETDDFVINASQKVKGFINAGGIQSPGLSAAPAIAEMVIEILKDE 357 Query: 367 FDKLDKKANW 376 +L+ K N+ Sbjct: 358 GLQLNYKQNY 367 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 488 Length adjustment: 32 Effective length of query: 355 Effective length of database: 456 Effective search space: 161880 Effective search space used: 161880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory