Align Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A; Succinyl-CoA:3-oxoacid CoA-transferase; OXCT A; EC 2.8.3.5 (characterized)
to candidate WP_068747324.1 ATZ99_RS00635 CoA transferase subunit A
Query= SwissProt::P56006 (232 letters) >NCBI__GCF_001601575.1:WP_068747324.1 Length = 219 Score = 209 bits (532), Expect = 3e-59 Identities = 107/220 (48%), Positives = 144/220 (65%), Gaps = 1/220 (0%) Query: 1 MNKVITDLDKALSALKDGDTILVGGFGLCGIPEYAIDYIYKKGIKDLIVVSNNCGVDDFG 60 MNK+ T +A+S++K G +++GGFG G P ID + + I +L ++SN+ G G Sbjct: 1 MNKLKT-AKEAISSIKPGSRVMIGGFGTAGYPNSLIDALCESKIDNLTIISNDLGSPGIG 59 Query: 61 LGILLEKKQIKKIIASYVGENKIFESQMLNGEIEVVLTPQGTLAENLHAGGAGIPAYYTP 120 LG LL Q+K +I +Y N G+IEV L PQGT AE + A G GIPA+YTP Sbjct: 60 LGRLLRNNQVKALIGTYYNWNPEVAEAKNQGKIEVTLVPQGTFAEAIRAAGVGIPAFYTP 119 Query: 121 TGVGTLIAQGKESREFNGKEYILERAITGDYGLIKAYKSDTLGNLVFRKTARNFNPLCAM 180 T VGT +++GKE R NGK+Y+LE AI D LIKAY +D LGNL++ KTARNFNP+ AM Sbjct: 120 TSVGTDLSEGKEIRLINGKQYVLEYAIKADVALIKAYIADELGNLIYYKTARNFNPIMAM 179 Query: 181 AAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEKFE 220 AA + + EV+E+VPAG L+P+ I P I+V I K E F+ Sbjct: 180 AADLVIVEVDEVVPAGSLNPEHIITPHIFVDIITKREAFQ 219 Lambda K H 0.317 0.140 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 219 Length adjustment: 22 Effective length of query: 210 Effective length of database: 197 Effective search space: 41370 Effective search space used: 41370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory