Align L-lysine 6-transaminase (EC 2.6.1.36) (characterized)
to candidate WP_157074746.1 ATZ99_RS09050 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Query= reanno::Pedo557:CA265_RS14455 (443 letters) >NCBI__GCF_001601575.1:WP_157074746.1 Length = 260 Score = 269 bits (688), Expect = 7e-77 Identities = 139/253 (54%), Positives = 178/253 (70%), Gaps = 6/253 (2%) Query: 14 SLSKHILADGFDLTYDMEKSHGAYIYDAKHNRTLLDFFTCFASVPLGYNHPKMINDEAFK 73 +L K+IL DGF + D+EKS+G+YI DAK LDF+T FAS PLG NHPK+ N+E FK Sbjct: 10 TLEKYILVDGFPIVIDLEKSYGSYIVDAKDGTDYLDFYTFFASSPLGLNHPKLANEE-FK 68 Query: 74 KNLFLAALANPSNSDVYTQQYAQFVETFSKVGIPDYLPHAFFIAGGGLAVENAIKVAMDW 133 + +F AA+ +NSD+YT + AQFV+TF +V P+ H F I G LAVENA+KVAMDW Sbjct: 69 ERVFRAAVNKVANSDIYTVEMAQFVKTFMEVAAPENFIHLFLIDYGTLAVENALKVAMDW 128 Query: 134 KVQKNFAKGYTE--EKGFKVLHFERAFHGRTGYTLSLTNTL-PDKTKWFAKF-DWPRVAV 189 KV+KN KGY E +KG KV+HF+ AFHGR+GY LSLTNT P K +F KF DWPR+ Sbjct: 129 KVRKNIDKGYKESAQKGTKVIHFKEAFHGRSGYALSLTNTADPRKYMYFTKFNDWPRITN 188 Query: 190 PEVKFPLSGNNLSHAIQTEETSLAQIKKAIADNKDDICAIIVEPIQSEGGDNHLREEFLI 249 P++ +PL +L + E ++ QIKKAIA+N DDICAII+E IQ EGGDNH R EF Sbjct: 189 PKIVWPLE-KHLDEVKRAENEAINQIKKAIAENPDDICAIIIETIQGEGGDNHFRPEFFR 247 Query: 250 QIKALADENDAFL 262 ++ + DEN+ L Sbjct: 248 ALREICDENEIML 260 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 260 Length adjustment: 28 Effective length of query: 415 Effective length of database: 232 Effective search space: 96280 Effective search space used: 96280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory