Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate WP_068747321.1 ATZ99_RS00620 2Fe-2S iron-sulfur cluster binding domain-containing protein
Query= uniprot:Q39TW6 (218 letters) >NCBI__GCF_001601575.1:WP_068747321.1 Length = 576 Score = 115 bits (289), Expect = 1e-30 Identities = 75/205 (36%), Positives = 103/205 (50%), Gaps = 29/205 (14%) Query: 4 INLQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEKLEPYGGCRICTVEVEVRGWPKLV 63 +NL ID V EG TILDAAK GI IPTLC+ E L+P G CR+C VEV+G L Sbjct: 2 LNLTIDNINVHVEEGATILDAAKKAGIYIPTLCYREDLKPMGVCRLCV--VEVKGAKNLQ 59 Query: 64 AGCIYPVEKGLVVRTRNEKIDKIRKVLLEEMLAHAP---------DSEELKALAQ----- 109 A C+ P +G++V+T + I K RK +LE +L++ P + EL+ +A Sbjct: 60 AACVTPASEGMIVKTNSPFIRKARKTILELILSNHPMECPACIRNGNCELQEMAYRLNIT 119 Query: 110 --EYGADRDRFEK---------HPSFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREIS-- 156 +Y ++ F K P+ CI C CV C EI+ + RG N I Sbjct: 120 DIKYSGEKSIFNKDETTPAIVRDPNKCILCRRCVNVCGEIQGIGIIEPHHRGFNTSIDPP 179 Query: 157 FIPEIAAKECWDCKECFPLCPTSAL 181 F ++ C C +C +CPT AL Sbjct: 180 FNQGLSKMPCAQCGQCVLVCPTGAL 204 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 576 Length adjustment: 29 Effective length of query: 189 Effective length of database: 547 Effective search space: 103383 Effective search space used: 103383 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory