Align Benzoyl-CoA reductase subunit D; 3-hydroxybenzoyl-CoA reductase subunit delta; EC 1.3.7.8; EC 1.3.99.n1 (characterized)
to candidate WP_068747499.1 ATZ99_RS01615 2-hydroxyglutaryl-CoA dehydratase
Query= SwissProt::O87877 (282 letters) >NCBI__GCF_001601575.1:WP_068747499.1 Length = 318 Score = 92.0 bits (227), Expect = 1e-23 Identities = 79/263 (30%), Positives = 127/263 (48%), Gaps = 22/263 (8%) Query: 6 GIDIGTGAVKTVLFRVEGDKTEWLAKRNDRIRQRDPFKLAEEAYNGLLEEAGLKASDVDY 65 GID+G+ + V+ G+ E + R Q P K +E L + K + Sbjct: 6 GIDVGSVSTNIVIIDDNGEVREAIYLRT----QGQPIKAVQEGLRMLANKE--KEYCIKG 59 Query: 66 VATTGEGESLAFHTGHF----YSMTTHARGAVYLNPEARAVLDIGALHGRAIRNDERGKV 121 V TTG G LA +T HA A P+ + V++IG + I + G V Sbjct: 60 VGTTGSGRQLAAVIVGADVVKNEITAHAVAAQKEVPDVQTVIEIGGQDSKIIILRD-GVV 118 Query: 122 ETYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSTQADNPEVVSSICAVLAETDVINMV 181 + M + CA+G+G FL+ A LGI +E GSL+ ++ NP ++ CAV AE+D+I+ Sbjct: 119 TDFAMNTVCAAGTGSFLDQQANRLGIPIEEFGSLALKSQNPVRIAGRCAVFAESDMIHKQ 178 Query: 182 SRGISAPNILKGIHISMAGRLAKLLKSVGARDGV---VLCTGGLALDEGLLKTLNESIQE 238 G +I++G+ ++ + L +VG + V+ GG+A + G+ E++Q Sbjct: 179 QLGHKLEDIIRGLCQAL---VRNYLNNVGKGKEILPRVVFQGGVAANLGMKAAFEEALQ- 234 Query: 239 QKMAVVAYNHPDSPYAGAIGAAL 261 ++ V Y+H GAIGAAL Sbjct: 235 MEVYVPKYHH----VMGAIGAAL 253 Lambda K H 0.316 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 318 Length adjustment: 27 Effective length of query: 255 Effective length of database: 291 Effective search space: 74205 Effective search space used: 74205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory