Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_068748022.1 ATZ99_RS04355 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_001601575.1:WP_068748022.1 Length = 234 Score = 236 bits (602), Expect = 3e-67 Identities = 119/233 (51%), Positives = 170/233 (72%), Gaps = 2/233 (0%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 ML+ +++ +YGKI AL V++ V++GEIV+++GANGAGKSTL+MT+ G + +G I + Sbjct: 1 MLEVRDINVYYGKIHALKGVSLSVKRGEIVSIVGANGAGKSTLMMTIAGILKPKNGKIMF 60 Query: 61 MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFT-DKGDYQEQMDKVLHL 119 +E+ S + I +VPE RR+FA LTV+ENL +G F DK + + M+ + L Sbjct: 61 ENKEIPPL-SHKVAEMGIILVPERRRLFANLTVKENLLLGAFLRKDKEEIRRDMEYIYTL 119 Query: 120 FPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQL 179 FP LK+R Q GT+SGGEQQMLA+GR LM+KP++LLLDEPSLGL+P+ +++F + ++ Sbjct: 120 FPILKQRERQFAGTLSGGEQQMLALGRGLMAKPRILLLDEPSLGLSPLFTKEVFSSLVKI 179 Query: 180 RKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 DGVT+ L EQNAN+AL+I+ +AY+LE GRVV+ GTG LL + K+REAYLG Sbjct: 180 NMDGVTILLSEQNANKALQISHKAYILETGRVVLSGTGMELLENQKIREAYLG 232 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 234 Length adjustment: 23 Effective length of query: 210 Effective length of database: 211 Effective search space: 44310 Effective search space used: 44310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory