Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate WP_068748742.1 ATZ99_RS08105 3-oxoacyl-ACP reductase FabG
Query= SwissProt::O18404 (255 letters) >NCBI__GCF_001601575.1:WP_068748742.1 Length = 246 Score = 142 bits (359), Expect = 5e-39 Identities = 85/255 (33%), Positives = 138/255 (54%), Gaps = 18/255 (7%) Query: 2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNE---VAKELGDKVVFVPVD 58 +KN + +VTGG G+GRATA + A++GA V +AD+ E + K+ G+ VD Sbjct: 3 LKNKICIVTGGGDGIGRATAVKFAEEGAVVAVADINEKAIEETVNIIKQKGNMAEGFKVD 62 Query: 59 VTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVG 118 VT + ++ + + + R+D+ VN AG + + + E F++VIN+N G Sbjct: 63 VTQKDQINEMVSKIMENYKRIDVLVNNAGIVKDAQLYKMSD------EQFEQVINVNLKG 116 Query: 119 TFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIAR 178 + R +M + GVI+NT+S+ G GQ Y+ASKAA++GMT A+ Sbjct: 117 VYLCTRAVIDIMISQNS------GVILNTSSIVGLYGNFGQTNYAASKAALIGMTRTWAK 170 Query: 179 DLSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQ--AIYE 236 +L +GIR + PG TP+L ++PEKV + + +P +RLG+P E A++ A E Sbjct: 171 ELGRKGIRCNAVCPGFIATPILKSMPEKVLLTMEEKVPM-RRLGKPEEVANVFAFLASDE 229 Query: 237 NPLLNGEVIRIDGAL 251 +NG ++ + G L Sbjct: 230 ASYVNGAIVEVSGGL 244 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 246 Length adjustment: 24 Effective length of query: 231 Effective length of database: 222 Effective search space: 51282 Effective search space used: 51282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory