Protein WP_067072406.1 in Methanoculleus horonobensis T10
Annotation: NCBI__GCF_001602375.1:WP_067072406.1
Length: 355 amino acids
Source: GCF_001602375.1 in NCBI
Candidate for 29 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 35% | 92% | 179.5 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
trehalose catabolism | treV | lo | TreV, component of Trehalose porter (characterized) | 38% | 81% | 174.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 34% | 95% | 159.5 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-glutamate catabolism | gltL | lo | GluA aka CGL1950, component of Glutamate porter (characterized) | 39% | 98% | 158.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 33% | 90% | 149.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 33% | 90% | 149.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-asparagine catabolism | aatP | lo | ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) | 35% | 100% | 144.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-aspartate catabolism | aatP | lo | ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) | 35% | 100% | 144.8 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-histidine catabolism | aapP | lo | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) | 33% | 91% | 141.7 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 33% | 98% | 140.6 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 33% | 98% | 140.6 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 33% | 93% | 140.2 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-arginine catabolism | artP | lo | ABC transporter for L-Arginine, putative ATPase component (characterized) | 35% | 89% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 32% | 92% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 32% | 92% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 32% | 92% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 32% | 92% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 32% | 92% | 139.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 34% | 91% | 139 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
D-glucosamine (chitosamine) catabolism | AO353_21725 | lo | ABC transporter for D-glucosamine, ATPase component (characterized) | 33% | 87% | 135.2 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-histidine catabolism | BPHYT_RS24015 | lo | ABC transporter related (characterized, see rationale) | 35% | 88% | 130.2 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-alanine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-isoleucine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-leucine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-serine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-threonine catabolism | braG | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-valine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) | 34% | 100% | 125.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
L-phenylalanine catabolism | livF | lo | High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) | 32% | 100% | 116.7 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
D-cellobiose catabolism | cbtF | lo | CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) | 31% | 69% | 105.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 44% | 294.7 |
Sequence Analysis Tools
View WP_067072406.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MIEFDRVSLALGSFRLNDVSLTISKGDYYFIVGPSGAGKTVLLEAIAGLHRPDSGRVLLR
GEEITALPPEKRNVALVYQDYSLFPNMRVIDNISYGLRVQGMGKKEARAEVAPLLERFGI
AHLADRYPGTLSGGEQQRVALARAVAVKPDILLLDEPLSALDPVTQEKFIDDLRRLHRED
GLTVVQVSHSRREAHLLATRMAVIIDGALVDEGKADVVLNAPKSREVASFVGIENILDGT
VTANEDGLATVIAGGLAFEAVTEAAAGEEVSLCIRADDVVLAVGDGRRTSARNTLAGTVV
SVAENGPVAEVRVDAGVTLTAVLTRRSVQEFGIVSGISVALSVKATAIHVIRSFS
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory