Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate WP_067073689.1 MCUHO_RS04035 amino acid ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_00475 (220 letters) >NCBI__GCF_001602375.1:WP_067073689.1 Length = 228 Score = 118 bits (295), Expect = 1e-31 Identities = 68/202 (33%), Positives = 106/202 (52%) Query: 17 LLAGLGLGLSLALVSIAIGCVIGLAMAFALLSKHRVLRVLASVYVTVIRNTPILVLILLI 76 L+ GL + L L S G +G+A+A H V+ L YV +I+ TP+L+L+ ++ Sbjct: 15 LMQGLIVTLQLIACSAPFGLALGIAVAVGRQYGHPVISWLCKTYVFLIKGTPLLLLLFIL 74 Query: 77 YFALPSLGIRLDKLPSFVITLSLYAGAYLTEVFRGGLLSIHKGQREAGLAIGLGEWQVKA 136 YF LPS+GI + V+ L GAY E RG L+SI +GQ A A+G+ WQ Sbjct: 75 YFGLPSIGITFTAFVASVVGFILCNGAYNAEYIRGALISIKEGQMVAAQALGMTRWQAIR 134 Query: 137 YVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIETWLVTTA 196 V +P L +P LSN FI L K +SLA I V EL+ + + + + E++ Sbjct: 135 NVILPQALCRAIPGLSNEFIYLIKYSSLAYMITVIELSGAGKLVATKYFTYTESFAAVGI 194 Query: 197 LYVAACYLIAMVLRYFEQRLAI 218 +Y+ + + + E+R+A+ Sbjct: 195 VYLVLVSITTIAVTILEKRVAV 216 Lambda K H 0.329 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 228 Length adjustment: 22 Effective length of query: 198 Effective length of database: 206 Effective search space: 40788 Effective search space used: 40788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory