Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_067072575.1 MCUHO_RS01395 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_001602375.1:WP_067072575.1 Length = 491 Score = 457 bits (1176), Expect = e-133 Identities = 228/461 (49%), Positives = 312/461 (67%), Gaps = 4/461 (0%) Query: 2 FSKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSYL 61 F K+L+ANRGEIA+RVMRAC ELG+ TVA+YSE D + HV+YADEA+ +G A + SYL Sbjct: 4 FDKILIANRGEIAIRVMRACRELGIDTVAIYSEPDNNALHVKYADEAFCVGEAHPSKSYL 63 Query: 62 DHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKARS 121 + E + + ARK A+AIHPGYGFLAENA FA+ VE+ T++GPS +E LG K ++ Sbjct: 64 NKERICDVARKTGAEAIHPGYGFLAENAGFAKLVEEEGLTFIGPSWKTIEALGSKIGSKR 123 Query: 122 LMQDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQF 181 +M++A VPV+PGT E S E+ K VA + GYPV +KA GGGG G+ + +E E++ Sbjct: 124 MMREAGVPVLPGTPEGVTSVEEAKKVAAEIGYPVIVKASAGGGGIGMHIAENEGELEEAI 183 Query: 182 ETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIEE 241 + R ++ F + +++VEKYL PRHIE+Q+LAD G+ HL +R+CS+QRRHQK++EE Sbjct: 184 DKGMRIAQSAFGDPTIFVEKYLTKPRHIEIQVLADAKGHTVHLYDRECSIQRRHQKLLEE 243 Query: 242 APSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVEDGEFYFMEVNTRIQVEHTVTEE 301 AP P ++ LRE++ +A +AA Y NAGTVEFL +G +YFMEVNTR+QVEHTVTE Sbjct: 244 APCPIMTPALREQMTASAIAAAKAANYKNAGTVEFLYANGNYYFMEVNTRLQVEHTVTEF 303 Query: 302 VTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDPPG 361 +TG+D+VK Q+ +AAGE+L Q+D+ I GH++E RINAE P FA G + Y PG Sbjct: 304 ITGIDMVKQQIAIAAGEDLAMGQEDIGIRGHAIECRINAEDPLNNFAADPGKIVRYRSPG 363 Query: 362 GIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVIPFH 421 G GIR+D + G I YDSMI+KL GSDREE + R RA+ E+ I G++T +P H Sbjct: 364 GPGIRVDSGIHMGYTIPAHYDSMISKLCALGSDREEAIQRMRRAIYEYVILGVKTTLPLH 423 Query: 422 RLMLTDEAFREGSHTTKYLDEVLDPERIEAAVERWSPEAVA 462 ++ + F G T +L E E I ++ R+ E A Sbjct: 424 YAIMHNAHFIAGDTHTHFLQE----EHIATSLRRYLHEEEA 460 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 670 Number of extensions: 26 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 491 Length adjustment: 35 Effective length of query: 566 Effective length of database: 456 Effective search space: 258096 Effective search space used: 258096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory